Crystal Structure of Yeast p58C Multi-Tyrosine Mutant 5YF431. Determined by X-ray diffraction at 2.07 Å resolution. Released 29 Jun 2022.
Explore 7TL3 in 3D Show helices and sheets RCSB PDB PDBe
7TL3 contains 16 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 323-325 | 3 | |
| α-helix | 327-330 | 4 | |
| α-helix | 335-347 | 13 | |
| α-helix | 352-364 | 13 | |
| α-helix | 369-380 | 12 | |
| α-helix | 382-384 | 3 | |
| α-helix | 388-394 | 7 | |
| α-helix | 396-403 | 8 | |
| α-helix | 413-415 | 3 | |
| α-helix | 417-422 | 6 | |
| α-helix | 424-426 | 3 | |
| α-helix | 435-438 | 4 | |
| α-helix | 441-450 | 10 | |
| α-helix | 455-467 | 13 | |
| α-helix | 470-481 | 12 | |
| α-helix | 500-510 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| DNA primase large subunit | A | protein | 201 | Saccharomyces cerevisiae | P20457 (AlphaFold model) |
>7TL3_1 DNA primase large subunit (chains A) GPGSDDEINAQSVWSEEISSNYPLCIKNLMEGLKKNHHLRFFGRQQLSLFLKGIGLSADE ALKFWSEAFTRNGNMTMEKFNKEFRFSFRHNYGLEGNRINYKPWDCHTILSKPRPGRGDF HGCPFRDWSHERLSAELRSMKLTQAQIISVLDSCQKGEYTIACTKVFEMTHNSASADLEI GEQTHIAHPNLYFERSRQLQK
| ID | Name | Formula | Copies |
|---|---|---|---|
| SF4 | Iron/sulfur cluster | Fe4 S4 | 1 |
Water and common crystallization additives (MPD) are not listed.
Modification of the 4Fe-4S Cluster Charge Transport Pathway Alters RNA Synthesis by Yeast DNA Primase. Salay, L.E., Blee, A.M., Raza, M.K. et al. Biochemistry (2022) 61:1113-1123. DOI 10.1021/acs.biochem.2c00100 · PubMed
Other PDB entries of the same protein (UniProt P20457 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7TL3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.