Human Bfl-1 in complex with the Bfl-1-specific designed peptide srt.F4. Determined by X-ray diffraction at 1.48 Å resolution. Released 17 Oct 2018.
Explore 6E3I in 3D Show helices and sheets RCSB PDB PDBe
6E3I contains 12 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 2-4 | 3 | |
| α-helix | 6-20 | 15 | |
| α-helix | 24-25 | 2 | |
| α-helix | 32-51 | 20 | |
| α-helix | 53-56 | 4 | |
| α-helix | 64-78 | 15 | |
| α-helix | 86-106 | 21 | |
| α-helix | 114-136 | 23 | |
| α-helix | 139 | 1 | |
| α-helix | 140-144 | 5 | |
| α-helix | 145-148 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 4-22 | 19 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Bcl-2-related protein A1 | A | protein | 152 | Homo sapiens | Q16548 (AlphaFold model) |
| peptide srt.F4 | B | protein | 23 | synthetic construct |
>6E3I_1 Bcl-2-related protein A1 (chains A) GMTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNV NVVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEIS YFVAEFIMNNTGEWIRQNGGWENGFVKKFEPK
>6E3I_2 peptide srt.F4 (chains B) XQRVVHIAAGLRRTGDQLEAYGX
Peptide design by optimization on a data-parameterized protein interaction landscape. Jenson, J.M., Xue, V., Stretz, L. et al. Proc Natl Acad Sci U S A (2018) 115:E10342-E10351. DOI 10.1073/pnas.1812939115 · PubMed
Other PDB entries of the same protein (UniProt Q16548 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6E3I directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.