The structure of the N-terminal domain of human clathrin heavy chain 1 (nTD) in complex with ES9. Determined by X-ray diffraction at 1.6 Å resolution. Released 24 Apr 2019.
Explore 6E4L in 3D Show helices and sheets RCSB PDB PDBe
6E4L contains 12 α-helices and 28 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 7-14 | 8 | 1 |
| α-helix | 15-18 | 4 | |
| α-helix | 22-24 | 3 | |
| β-strand | 30-34 | 5 | 2 |
| β-strand | 37-44 | 8 | 2 |
| β-strand | 47-54 | 8 | 2 |
| β-strand | 62-64 | 3 | 2 |
| β-strand | 70-73 | 4 | 3 |
| β-strand | 79-84 | 6 | 3 |
| β-strand | 87-92 | 6 | 3 |
| β-strand | 97-103 | 7 | 3 |
| β-strand | 108-113 | 6 | 4 |
| β-strand | 118-123 | 6 | 4 |
| β-strand | 126-131 | 6 | 4 |
| α-helix | 136-138 | 3 | |
| β-strand | 139-143 | 5 | 4 |
| α-helix | 144-145 | 2 | |
| α-helix | 146-148 | 3 | |
| α-helix | 151 | 1 | |
| β-strand | 152-158 | 7 | 5 |
| β-strand | 164-173 | 10 | 5 |
| β-strand | 176-185 | 10 | 5 |
| β-strand | 190-194 | 5 | 5 |
| β-strand | 198-204 | 7 | 6 |
| β-strand | 213-222 | 10 | 6 |
| β-strand | 225-232 | 8 | 6 |
| α-helix | 235-237 | 3 | |
| α-helix | 240-245 | 6 | |
| β-strand | 246-249 | 4 | 6 |
| α-helix | 254-256 | 3 | |
| β-strand | 261-267 | 7 | 7 |
| β-strand | 272-277 | 6 | 7 |
| β-strand | 281-286 | 6 | 7 |
| β-strand | 292-297 | 6 | 7 |
| β-strand | 303-309 | 7 | 1 |
| α-helix | 310-312 | 3 | |
| β-strand | 314-319 | 6 | 1 |
| β-strand | 323-329 | 7 | 1 |
| α-helix | 334-340 | 7 | |
| α-helix | 345-354 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Clathrin heavy chain 1 | A | protein | 369 | Homo sapiens | Q00610 (AlphaFold model) |
>6E4L_1 Clathrin heavy chain 1 (chains A) GSPEFMAQILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDM NDPSNPIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWIS LNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQN RVVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGT PPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYM NRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRN NLAGAEELF
| ID | Name | Formula | Copies |
|---|---|---|---|
| HRS | 5-bromo-N-(4-nitrophenyl)thiophene-2-sulfonamide | C10 H7 Br N2 O4 S2 | 1 |
Water and common crystallization additives (DMS, GOL, ACT, EDO) are not listed.
Disruption of endocytosis through chemical inhibition of clathrin heavy chain function. Dejonghe, W., Sharma, I., Denoo, B. et al. Nat Chem Biol (2019) 15:641-649. DOI 10.1038/s41589-019-0262-1 · PubMed
Other PDB entries of the same protein (UniProt Q00610 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6E4L directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.