6EF5: 14-3-3 with peptide

14-3-3 with peptide. Determined by X-ray diffraction at 2.44 Å resolution. Released 30 Oct 2019.

Method: X-ray diffraction
Resolution: 2.44 Å
Organism: Homo sapiens
Chains: 8
Atoms: 7,349
Mol. weight: 115.11 kDa
Released: 30 Oct 2019

Explore 6EF5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6EF5 contains 46 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	3-15	13
α-helix	19-31	13
α-helix	35-37	3
α-helix	38-67	30
α-helix	73-99	27
α-helix	100-105	6
α-helix	112-130	19
α-helix	135-159	25
α-helix	165-180	16
α-helix	185-200	16
α-helix	212-228	17

Chains B and D: 12 helices, 0 β-strands

Element	Residues	Length
α-helix	3-15	13
α-helix	19-31	13
α-helix	35-37	3
α-helix	38-67	30
α-helix	73-99	27
α-helix	100-105	6
α-helix	112-130	19
α-helix	135-159	25
α-helix	165-180	16
α-helix	185-200	16
α-helix	208-210	3
α-helix	212-228	17

Chain C: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	3-15	13
α-helix	19-31	13
α-helix	35-37	3
α-helix	38-67	30
α-helix	75-99	25
α-helix	100-105	6
α-helix	112-130	19
α-helix	135-159	25
α-helix	165-180	16
α-helix	185-200	16
α-helix	212-228	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
14-3-3 protein zeta/delta	A, B, C, D	protein	248	Homo sapiens	P63104 (AlphaFold model)
Arg-ser-leu-sep-ala-pro-gly	Q, S	protein	7	Homo sapiens	Q96RR4 (AlphaFold model)
Lys-leu-sep-leu-gln	P, R	protein	5	Homo sapiens

Sequence of entity 1 (A, B, C, D), FASTA

>6EF5_1 14-3-3 protein zeta/delta (chains A, B, C, D)
GSHMDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRS
SWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVF
YLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVF
YYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEA
EAGEGGEN

Sequence of entity 2 (Q, S), FASTA

>6EF5_2 ARG-SER-LEU-SEP-ALA-PRO-GLY (chains Q, S)
RSLSAPG

Sequence of entity 3 (P, R), FASTA

>6EF5_3 LYS-LEU-SEP-LEU-GLN (chains P, R)
KLSLQ

Primary citation

14-3-3 with peptide. Dhagat, U., Langendorf, C.G., Oakhill, J.S. et al. To be published.

Other PDB entries of the same protein (UniProt P63104 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2O02 1.5 Å, Phosphorylation independent interactions between 14-3-3 and Exoenzyme S: from structure…
6F09 1.59 Å, Binary complex of 14-3-3 zeta with ubiquitin specific protease 8 (USP8) pSer718 peptide
7ZIT 1.79 Å, 14-3-3 in complex with SARS-COV2 N phospho-peptide
9UJ2 1.8 Å, 14-3-3 zeta chimera with the S202R peptide of SARS-CoV-2 N (residues 200-213)
6ZFG 1.85 Å, 14-3-3 zeta chimera with 18E6 and fusicoccin
6F08 1.9 Å, 14-3-3 zeta in complex with the human Son of sevenless homolog 1 (SOS1)
6ZFD 1.9 Å, 14-3-3 zeta bound to the phosphorylated 18E6 C-terminus
4FJ3 1.95 Å, 14-3-3 isoform zeta in complex with a diphoyphorylated C-RAF peptide
5EXA 1.95 Å, Small-molecule stabilization of the 14-3-3/Gab2 PPI interface
8P1H 1.95 Å, Crystal structure of the chimera of human 14-3-3 zeta and phosphorylated cytoplasmic…
8A9G 1.96 Å, Binary complex of 14-3-3 zeta Glucocorticoid Receptor (GR) pT524 peptide stabilised by…
1QJA 2.0 Å, 14-3-3 zeta/phosphopeptide complex (mode 2)

Browse structure collections

About this viewer

MolViewer shows 6EF5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.