Tryptophan Repressor TrpR from E.coli variant T44L T81M S88Y with Indole-3-acetic acid as ligand. Determined by X-ray diffraction at 1.46 Å resolution. Released 30 Jan 2019.
Explore 6EKP in 3D Show helices and sheets RCSB PDB PDBe
6EKP contains 12 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 6-31 | 26 | |
| α-helix | 35-42 | 8 | |
| α-helix | 45-63 | 19 | |
| α-helix | 68-75 | 8 | |
| α-helix | 79-91 | 13 | |
| α-helix | 94-104 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Trp operon repressor | A, B | protein | 116 | Escherichia coli (strain K12) | P0A881 (AlphaFold model) |
>6EKP_1 Trp operon repressor (chains A, B) MAQQSPYSAAMAEQRHQEWLRFVDLLKNAYQNDLHLPLLNLMLLPDEREALGTRVRIVEE LLRGEMSQRELKNELGAGIAMITRGSNYLKAAPVELRQWLEEVLLKSDLEHHHHHH
| ID | Name | Formula | Copies |
|---|---|---|---|
| IAC | 1H-indol-3-ylacetic acid | C10 H9 N O2 | 2 |
| P3G | 3,6,9,12,15-pentaoxaheptadecane | C12 H26 O5 | 1 |
A biosensor for the direct visualization of auxin. Herud-Sikimic, O., Stiel, A.C., Kolb, M. et al. Nature (2021). DOI 10.1038/s41586-021-03425-2
Other PDB entries of the same protein (UniProt P0A881 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6EKP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.