6EXW: CIAP1-BIR3

Crystal structure of cIAP1-BIR3 in complex with a covalently bound SM. Determined by X-ray diffraction at 2.2 Å resolution. Released 8 Aug 2018.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,827
Mol. weight: 29.85 kDa
Ligands: ZN, C3K
Released: 8 Aug 2018

Explore 6EXW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6EXW contains 10 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	258-260	3
α-helix	263-268	6
α-helix	281-286	6
β-strand	289-291	3	1
β-strand	298-300	3	1
β-strand	306-307	2	1
α-helix	316-323	8
α-helix	328-345	18

Chain C: 5 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	258-260	3
α-helix	263-269	7
α-helix	281-286	6
β-strand	289-291	3	2
β-strand	298-300	3	2
β-strand	306-307	2	2
α-helix	316-323	8
α-helix	328-345	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Baculoviral IAP repeat-containing protein 2	A, C	protein	122	Homo sapiens	Q13490 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>6EXW_1 Baculoviral IAP repeat-containing protein 2 (chains A, C)
MENSLETLRFSISNLSMQTHAARMRTFMYWPSSVPVQPEQLASAGFYYVGRNDDVKCFCC
DGGLRCWESGDDPWVEHAKWFPRCEFLIRMKGQEFVDEIQGRYPHLLEQLLSTSLEHHHH
HH

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2
C3K	(3~{S},6~{S},7~{R},9~{a}~{S})-6-[[(2~{S})-2-(methylamino)propanoyl]amino]-5-oxi…	C25 H35 N5 O4	2

Primary citation

Structure-based design and molecular profiling of Smac-mimetics selective for cellular IAPs. Corti, A., Milani, M., Lecis, D. et al. FEBS J (2018) 285:3286-3298. DOI 10.1111/febs.14616 · PubMed

Other PDB entries of the same protein (UniProt Q13490 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4HY4 1.25 Å, Crystal structure of cIAP1 BIR3 bound to T3170284
7QGJ 1.3 Å, Apo structure of BIR2 Domain of BIRC2
3D9T 1.5 Å, CIAP1-BIR3 in complex with N-terminal peptide from Caspase-9 (ATPFQE)
8DSF 1.5 Å, Structure of cIAP1 with BCCov
4KMN 1.52 Å, Structure of cIAP1-BIR3 and inhibitor
4LGE 1.55 Å, Crystal structure of clAP1 BIR3 bound to T3261256
6HPR 1.7 Å, Crystal structure of cIAP1 RING domain bound to UbcH5B-Ub and a non-covalent Ub
7TRL 1.74 Å, Crystal structure of human BIRC2 BIR3 domain in complex with histone H3
4HY5 1.75 Å, Crystal structure of cIAP1 BIR3 bound to T3256336
3UW4 1.79 Å, Crystal structure of cIAP1 BIR3 bound to GDC0152
4MU7 1.79 Å, Crystal structure of cIAP1 BIR3 bound to T3450325
5M6N 1.8 Å, Small Molecule inhibitors of IAP

Browse structure collections

About this viewer

MolViewer shows 6EXW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.