6FSA: Beta-Cardiac myosin post-rigor

Beta-Cardiac myosin post-rigor. Determined by X-ray diffraction at 2.33 Å resolution. Released 25 Jul 2018.

Method: X-ray diffraction
Resolution: 2.33 Å
Organism: Bos taurus
Chains: 4
Atoms: 15,508
Mol. weight: 492.41 kDa
Ligands: ADP, MG
Released: 25 Jul 2018

Explore 6FSA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6FSA contains 96 α-helices and 65 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 42 helices, 30 β-strands

Element	Residues	Length	Sheet
α-helix	4-15	12
α-helix	20-27	8
β-strand	36-41	6	1
β-strand	45-53	9	1
β-strand	58-63	6	1
α-helix	64-66	3
β-strand	68-72	5	1
α-helix	73-75	3
β-strand	77-78	2	1
α-helix	79-81	3
α-helix	82-84	3
β-strand	89	1	2
α-helix	90-92	3
α-helix	98-110	13
β-strand	115-118	4	2
β-strand	121-125	5	2
α-helix	136-142	7
α-helix	147-149	3
α-helix	154-168	15
β-strand	171-178	8	2
α-helix	184-198	15
β-strand	200	1	3
α-helix	201	1
α-helix	205-207	3
α-helix	216-231	16
β-strand	232-233	2	4
β-strand	241-242	2	4
β-strand	245-252	8	2
α-helix	254-256	3
β-strand	257	1	3
β-strand	258-266	9	2
α-helix	270-273	4
β-strand	283	1	4
α-helix	284-290	7
α-helix	296-301	6
α-helix	307-309	3
α-helix	325-338	14
α-helix	343-359	17
β-strand	364-366	3	5
α-helix	367	1
β-strand	373-375	3	5
α-helix	379-388	10
α-helix	392-400	9
β-strand	403-404	2	6
β-strand	411-412	2	6
α-helix	417-446	30
β-strand	448	1	2
β-strand	455-461	7	2
α-helix	463-465	3
β-strand	471	1	7
α-helix	473-504	32
α-helix	515-525	11
α-helix	530-538	9
α-helix	545-556	12
β-strand	563-564	2	7
β-strand	577-581	5	7
β-strand	584-588	5	7
α-helix	593-598	6
α-helix	603-610	8
α-helix	615-621	7
α-helix	647-662	16
β-strand	665-673	9	2
α-helix	686-695	10
α-helix	698-706	9
β-strand	711-714	4	8
α-helix	715-722	8
α-helix	723-725	3
α-helix	738-748	11
β-strand	756-758	3	8
β-strand	762-765	4	8
α-helix	769-799	31
α-helix	802-805	4

Chain B: 38 helices, 27 β-strands

Element	Residues	Length	Sheet
α-helix	4-15	12
α-helix	20-27	8
β-strand	36-41	6	9
β-strand	45-53	9	9
β-strand	58-63	6	9
β-strand	68-72	5	9
α-helix	73-75	3
β-strand	77-78	2	9
α-helix	79-81	3
α-helix	82-84	3
β-strand	89	1	10
α-helix	90-92	3
α-helix	98-110	13
β-strand	115-118	4	10
β-strand	121-125	5	10
α-helix	136-142	7
α-helix	147-149	3
α-helix	154-168	15
β-strand	171-177	7	10
α-helix	184-198	15
β-strand	200	1	11
α-helix	201-202	2
α-helix	216-231	16
β-strand	232-233	2	12
β-strand	241-242	2	12
β-strand	245-252	8	10
β-strand	257	1	11
β-strand	258-266	9	10
α-helix	270-273	4
β-strand	283	1	12
α-helix	284-290	7
α-helix	296-301	6
α-helix	307-309	3
α-helix	325-338	14
α-helix	343-359	17
β-strand	364-366	3	13
α-helix	367	1
β-strand	373-375	3	13
α-helix	379-388	10
α-helix	392-400	9
α-helix	417-447	31
β-strand	455-461	7	10
β-strand	471	1	14
α-helix	473-504	32
α-helix	515-525	11
α-helix	530-538	9
α-helix	545-556	12
β-strand	563-564	2	14
β-strand	577-581	5	14
β-strand	584-588	5	14
α-helix	593-598	6
α-helix	603-610	8
α-helix	615-621	7
α-helix	647-662	16
β-strand	665-673	9	10
α-helix	686-695	10
α-helix	698-706	9
β-strand	711-714	4	15
α-helix	715-722	8
α-helix	723-725	3
α-helix	727-729	3
α-helix	738-748	11
β-strand	756-758	3	15
β-strand	762-765	4	15
α-helix	769-796	28

Chains D and H: 8 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	52-64	13
β-strand	75-76	2	16
α-helix	80-86	7
α-helix	93-99	7
β-strand	112-113	2	16
α-helix	115-126	12
α-helix	134-142	9
β-strand	152-153	2	17
α-helix	154-163	10
α-helix	170-176	7
β-strand	186-187	2	17
α-helix	191-196	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Myosin-7	A, B	protein	1935	Bos taurus	Q9BE39 (AlphaFold model)
Myosin light chain 3	D, H	protein	199	Bos taurus	P85100 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6FSA_1 Myosin-7 (chains A, B)
MVDAEMAAFGEAAPYLRKSEKERLEAQTRPFDLKKDVFVPDDKEEFVKATILSREGGKVT
AETEHGKTVTVKEDQVLQQNPPKFDKIEDMAMLTFLHEPAVLYNLKERYASWMIYTYSGL
FCVTINPYKWLPVYNAEVVAAYRGKKRSEAPPHIFSISDNAYQYMLTDRENQSILITGES
GAGKTVNTKRVIQYFAVIAAIGDRSKKEQATGKGTLEDQIIQANPALEAFGNAKTVRNDN
SSRFGKFIRIHFGATGKLASADIETYLLEKSRVIFQLKAERDYHIFYQILSNKKPELLDM
LLITNNPYDYAFISQGETTVASIDDAEELMATDNAFDVLGFTTEEKNSMYKLTGAIMHFG
NMKFKLKQREEQAEPDGTEEADKSAYLMGLNSADLLKGLCHPRVKVGNEYVTKGQNVQQV
VYAKGALAKAVYERMFNWMVTRINATLETKQPRQYFIGVLDIAGFEIFDFNSFEQLCINF
TNEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLQACIDLIEKPMGIMSILEEECMF
PKATDMTFKAKLFDNHLGKSSNFQKPRNIKGKPEAHFSLIHYAGTVDYNIIGWLQKNKDP
LNETVVDLYKKSSLKMLSSLFANYAGFDTPIEKGKGKAKKGSSFQTVSALHRENLNKLMT
NLRSTHPHFVRCIIPNETKSPGVIDNPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFRQ
RYRILNPAAIPEGQFIDSRKGAEKLLGSLDIDHNQYKFGHTKVFFKAGLLGLLEEMRDER
LSRIITRIQAQSRGVLSRMEFKKLLERRDSLLIIQWNIRAFMGVKNWPWMKLYFKIKPLL
KSAETEKEIALMKEEFGRLKEALEKSEARRKELEEKMVSLLQEKNDLQLQVQAEQDNLAD
AEERCDQLIKNKIQLEAKVKEMTERLEDEEEMNAELTAKKRKLEDECSELKRDIDDLELT
LAKVEKEKHATENKVKNLTEEMAGLDEIIAKLTKEKKALQEAHQQALDDLQAEEDKVNTL
TKAKVKLEQHVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQESIMDLENDKQQLDERL
KKKDFELNALNARIEDEQALGSQLQKKLKELQARIEELEEELEAERTARAKVEKLRSDLS
RELEEISERLEEAGGATSVQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHADSV
AELSEQIDNLQRVKQKLEKEKSEFKLELDDVTSNMEQIIKAKANLEKMCRTLEDQMNEHR
SKAEETQRSVNDLTSQRAKLQTENGELSRQLDEKEALISQLTRGKLTYTQQLEDLKRQLE
EEVKAKNALAHALQSARHDCDLLREQYEEETEAKAELQRVLSKANSEVAQWRTKYETDAI
QRTEELEEAKKKLAQRLQDAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAAAA
ALDKKQRNFDKILAEWKQKYEESQSELESSQKEARSLSTELFKLKNAYEESLEHLETFKR
ENKNLQEEISDLTEQLGSSGKTIHELEKVRKQLEAEKLELQSALEEAEASLEQEEGKILR
AQLEFNQIKAEMERKLAEKDEEMEQAKRNHLRVVDSLQTSLDAETRSRNEALRVKKKMEG
DLNEMEIQLSHANRLAAEAQKQVKSLQSLLKDTQIQLDDAVRANDDLKENIAIVERRNNL
LQAELEELRAVVEQTERSRKLAEQELIETSERVQLLHSQNTSLINQKKKMEADLSQLQTE
VEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEA
EQIALKGGKKQLQKLEARVRELENELEAEQKRNAESVKGMRKSERRIKELTYQTEEDRKN
LLRLQDLVDKLQLKVKAYKRQAEEAEEQANTNLSKFRKVQHELDEAEERADIAESQVNKL
RAKSRDIGTKGLNEE

Sequence of entity 2 (D, H), FASTA

>6FSA_2 Myosin light chain 3 (chains D, H)
MAPKKPDPKKDEAKAGAKAAAAPAPAPAPPPAPEPSKEPEFDPSKIKIEFTPEQIEEFKE
AFTLFDRTPKCEMKITYGQCGDVLRALGQNPTQAEVLRVLGKPKQEELNSKMMDFDTFLP
MLQHISKNKDTGTYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKLTEDEVEKLMAGQ
EDSNGCINYEAFVKHIMAG

Ligands and cofactors

ID	Name	Formula	Copies
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	2
MG	Magnesium ion	Mg	2

Water and common crystallization additives (EDO, FMT) are not listed.

Primary citation

Hypertrophic cardiomyopathy disease results from disparate impairments of cardiac myosin function and auto-inhibition. Robert-Paganin, J., Auguin, D., Houdusse, A. Nat Commun (2018) 9:4019-4019. DOI 10.1038/s41467-018-06191-4 · PubMed

Other PDB entries of the same protein (UniProt Q9BE39 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8QYR 1.8 Å, Beta-cardiac myosin motor domain in the pre-powerstroke state complexed to Mavacamten
8QYU 1.96 Å, Beta-cardiac myosin S1 fragment in the pre-powerstroke state complexed to Omecamtiv…
9F6C 2.33 Å, Cardiac myosin motor domain in the pre-powerstroke state co-crystallized with the…
5N69 2.45 Å, Cardiac muscle myosin S1 fragment in the pre-powerstroke state co-crystallized with the…
8QYQ 2.61 Å, Beta-cardiac myosin S1 fragment in the pre-powerstroke state complexed to Mavacamten
8QYP 2.76 Å, Beta-cardiac myosin motor domain in the pre-powerstroke state
5N6A 3.1 Å, Cardiac muscle myosin motor domain in the pre-powerstroke state
6X5Z 4.24 Å, Bovine Cardiac Myosin in Complex with Chicken Skeletal Actin and Human Cardiac…

Browse structure collections

About this viewer

MolViewer shows 6FSA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.