7D35: Human LC8

Human LC8 bound to ebola virus VP35(67-76). Determined by X-ray diffraction at 2.4 Å resolution. Released 14 Apr 2021.

Method: X-ray diffraction
Resolution: 2.4 Å
Organisms: Homo sapiens, Ebola virus
Chains: 2
Atoms: 807
Mol. weight: 11.76 kDa
Released: 14 Apr 2021

Explore 7D35 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7D35 contains 2 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	6-12	7	1
α-helix	15-31	17
α-helix	35-50	16
β-strand	54-59	6	1
β-strand	63-67	5	2
β-strand	73-78	6	1
β-strand	81-87	7	1

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	70-74	5	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Dynein light chain 1, cytoplasmic	A	protein	91	Homo sapiens	P63167 (AlphaFold model)
Peptide from Polymerase cofactor VP35	B	protein	10	Ebola virus	Q05127 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7D35_1 Dynein light chain 1, cytoplasmic (chains A)
GHMCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIV
GRNFGSYVTHETKHFIYFYLGQVAILLFKSG

Sequence of entity 2 (B), FASTA

>7D35_2 Peptide from Polymerase cofactor VP35 (chains B)
KTRNSQTQTD

Primary citation

Crystal structure of human LC8 bound to a peptide from Ebola virus VP35. Lim, D., Shin, H.C., Choi, J.S. et al. J Microbiol (2021) 59:410-416. DOI 10.1007/s12275-021-0641-7 · PubMed

Other PDB entries of the same protein (UniProt P63167 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9NZ7 1.41 Å, Crystal structure of human DYNLL1-S64A/S88A mutant dimer
6GZL 1.95 Å, Complex between the dynein light chain DYNLL1/DLC8 and a peptide from the large…
6GZJ 1.98 Å, Complex between the dynein light chain DYNLL1/DLC8 and the specific domain of large…
3ZKE 2.2 Å, Structure of LC8 in complex with Nek9 peptide
1CMI 2.5 Å, Structure of the human PIN/LC8 dimer with a bound peptide
3ZKF 2.6 Å, Structure of LC8 in complex with Nek9 phosphopeptide
9BLY 3.5 Å, Composite structure of full-length human dynein-1 in phi-particle conformation
6SC2 3.9 Å, Structure of the dynein-2 complex; IFT-train bound model
8RGG 4.0 Å, Structure of dynein-2 intermediate chain DYNC2I2 (WDR34) in complex with dynein-2 heavy…
9E28 4.4 Å, Cryo-EM structure of Phi dynein tail
6RLB 4.5 Å, Structure of the dynein-2 complex; tail domain
9E12 4.5 Å, Full-length human dynein-1 in phi comformation under Lis1 condition

Browse structure collections

About this viewer

MolViewer shows 7D35 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.