9NZ7: Human DYNLL1-S64A/S88A mutant dimer

Crystal structure of human DYNLL1-S64A/S88A mutant dimer. Determined by X-ray diffraction at 1.41 Å resolution. Released 15 Apr 2026.

Method: X-ray diffraction
Resolution: 1.41 Å
Organism: Homo sapiens
Chains: 3
Atoms: 2,333
Mol. weight: 31.87 kDa
Released: 15 Apr 2026

Explore 9NZ7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9NZ7 contains 7 α-helices and 12 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 2 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	6-13	8	1
α-helix	15-31	17
α-helix	35-50	16
β-strand	54-65	12	1
β-strand	68-78	11	1
β-strand	81-88	8	1

Chain C: 3 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	1-3	3
β-strand	6-13	8	2
α-helix	15-31	17
α-helix	35-50	16
β-strand	55-59	5	2
β-strand	68-78	11	2
β-strand	81-88	8	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Dynein light chain 1, cytoplasmic	A, B, C	protein	92	Homo sapiens	P63167 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>9NZ7_1 Dynein light chain 1, cytoplasmic (chains A, B, C)
SNAMCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCI
VGRNFGAYVTHETKHFIYFYLGQVAILLFKAG

Primary citation

Crystal structure of human DYNLL1-S64A/S88A mutant dimer. Syed, A., Arvai, A.S., Chowdhury, D. et al. To be published.

Other PDB entries of the same protein (UniProt P63167 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6GZL 1.95 Å, Complex between the dynein light chain DYNLL1/DLC8 and a peptide from the large…
6GZJ 1.98 Å, Complex between the dynein light chain DYNLL1/DLC8 and the specific domain of large…
3ZKE 2.2 Å, Structure of LC8 in complex with Nek9 peptide
7D35 2.4 Å, Human LC8 bound to ebola virus VP35(67-76)
1CMI 2.5 Å, Structure of the human PIN/LC8 dimer with a bound peptide
3ZKF 2.6 Å, Structure of LC8 in complex with Nek9 phosphopeptide
9BLY 3.5 Å, Composite structure of full-length human dynein-1 in phi-particle conformation
6SC2 3.9 Å, Structure of the dynein-2 complex; IFT-train bound model
8RGG 4.0 Å, Structure of dynein-2 intermediate chain DYNC2I2 (WDR34) in complex with dynein-2 heavy…
9E28 4.4 Å, Cryo-EM structure of Phi dynein tail
6RLB 4.5 Å, Structure of the dynein-2 complex; tail domain
9E12 4.5 Å, Full-length human dynein-1 in phi comformation under Lis1 condition

Browse structure collections

About this viewer

MolViewer shows 9NZ7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.