6H04: Complement component C9

Closed conformation of the Membrane Attack Complex. Determined by electron microscopy at 5.6 Å resolution. Released 19 Dec 2018.

Method: Electron microscopy
Resolution: 5.6 Å
Organism: Homo sapiens
Chains: 24
Atoms: 97,178
Mol. weight: 1630.27 kDa
Ligands: NAG
Released: 19 Dec 2018

Explore 6H04 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6H04 contains 379 α-helices and 557 β-strands across 24 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 27 helices, 92 β-strands

Element	Residues	Length	Sheet
β-strand	24-28	5	78
β-strand	31-32	2	79
β-strand	37-42	6	78
β-strand	52-57	6	80
β-strand	67-71	5	80
β-strand	80-85	6	78
α-helix	92	1
β-strand	103-108	6	80
β-strand	112-116	5	80
β-strand	119-120	2	79
β-strand	125-130	6	81
β-strand	134-135	2	82
β-strand	140-141	2	83
β-strand	143-148	6	81
β-strand	159-164	6	84
β-strand	173-176	4	84
β-strand	182-184	3	81
α-helix	186-187	2
β-strand	188-189	2	83
β-strand	197-198	2	82
β-strand	200-204	5	84
β-strand	213-215	3	84
β-strand	218-219	2	82
β-strand	228-233	6	85
α-helix	241-244	4
β-strand	246-253	8	85
α-helix	258	1
β-strand	259	1	85
α-helix	260	1
β-strand	262-271	10	86
β-strand	287-293	7	86
β-strand	296	1	86
β-strand	297-301	5	85
α-helix	303-309	7
β-strand	323-330	8	86
β-strand	337-341	5	86
β-strand	353-356	4	87
β-strand	362-363	2	88
β-strand	369-376	8	87
β-strand	382	1	87
β-strand	387-396	10	88
β-strand	402-403	2	88
α-helix	404-406	3
β-strand	407-410	4	88
β-strand	417-422	6	87
β-strand	428-437	10	88
β-strand	449-456	8	88
β-strand	467	1	89
β-strand	476	1	90
β-strand	482-486	5	89
β-strand	499-505	7	91
β-strand	508-515	8	91
β-strand	524-528	5	89
α-helix	532-534	3
β-strand	538-544	7	91
β-strand	555-561	7	91
β-strand	563	1	90
β-strand	572-575	4	92
β-strand	582	1	93
β-strand	587-593	7	92
β-strand	598-606	9	94
α-helix	613-615	3
α-helix	624-627	4
α-helix	628-630	3
α-helix	642-649	8
β-strand	651-654	4	78
β-strand	773-780	8	94
β-strand	783-789	7	92
α-helix	796	1
β-strand	797-804	8	94
β-strand	809-811	3	94
α-helix	812-814	3
β-strand	815-817	3	94
β-strand	819	1	93
β-strand	823-827	5	95
β-strand	833-834	2	96
β-strand	839	1	97
β-strand	842-847	6	95
β-strand	853-861	9	98
β-strand	865-866	2	99
β-strand	886-888	3	98
β-strand	892-897	6	95
β-strand	900	1	97
β-strand	901-902	2	99
β-strand	908-916	9	98
β-strand	921-927	7	98
β-strand	929-930	2	96
β-strand	935-937	3	100
β-strand	941-944	4	100
β-strand	945	1	101
β-strand	954	1	101
β-strand	957-959	3	102
β-strand	967	1	103
α-helix	968	1
β-strand	974-979	6	100
α-helix	995-998	4
α-helix	1011-1028	18
α-helix	1038-1058	21
β-strand	1060	1	104
β-strand	1066	1	104
α-helix	1076-1090	15
α-helix	1098-1110	13
β-strand	1112	1	105
β-strand	1118	1	105
α-helix	1135-1154	20
α-helix	1162-1178	17
α-helix	1185-1196	12
α-helix	1203-1214	12
β-strand	1217-1219	3	106
β-strand	1225-1227	3	106
α-helix	1248-1260	13
α-helix	1264-1275	12
α-helix	1290-1306	17
β-strand	1312-1317	6	102
β-strand	1322-1327	6	102
β-strand	1338-1340	3	100
β-strand	1346-1350	5	102
β-strand	1357-1365	9	100
β-strand	1367	1	103

Chain B: 23 helices, 55 β-strands

Element	Residues	Length	Sheet
α-helix	28-32	5
β-strand	43-46	4	146
α-helix	54-58	5
α-helix	61-64	4
β-strand	69-72	4	146
α-helix	79-82	4
β-strand	87	1	147
α-helix	89-92	4
β-strand	99-100	2	148
β-strand	103	1	149
β-strand	104	1	147
β-strand	122	1	149
β-strand	125-126	2	148
β-strand	144-145	2	150
β-strand	151-152	2	150
α-helix	154-156	3
β-strand	185-186	2	151
α-helix	187	1
α-helix	190-193	4
β-strand	195	1	152
β-strand	196-197	2	153
β-strand	207	1	152
β-strand	209	1	154
β-strand	220-223	4	151
β-strand	226-231	6	151
β-strand	236-238	3	155
β-strand	244-245	2	156
β-strand	253-277	25	114
β-strand	293-319	27	114
β-strand	320-321	2	156
β-strand	326-327	2	155
β-strand	334	1	154
α-helix	336-343	8
α-helix	351-361	11
β-strand	364-365	2	153
β-strand	368	1	155
β-strand	369-372	4	157
β-strand	374-381	8	114
β-strand	384-408	25	114
β-strand	411-435	25	114
β-strand	438-444	7	114
α-helix	450-452	3
α-helix	453-458	6
α-helix	459-461	3
α-helix	467-478	12
β-strand	481-485	5	157
β-strand	489	1	153
α-helix	490-492	3
α-helix	500-517	18
α-helix	524-526	3
β-strand	531-535	5	158
β-strand	538-542	5	158
α-helix	543	1
α-helix	570	1
β-strand	571	1	159
α-helix	572-576	5
β-strand	583-586	4	160
β-strand	587	1	159
β-strand	606-609	4	160
β-strand	629	1	106
β-strand	644-645	2	161
β-strand	655	1	162
β-strand	661-662	2	161
α-helix	663	1
β-strand	667-668	2	163
β-strand	670	1	162
α-helix	672-673	2
β-strand	677-680	4	164
β-strand	684-685	2	163
β-strand	686	1	165
β-strand	692	1	165
β-strand	697-700	4	164
β-strand	703-705	3	166
α-helix	706-707	2
β-strand	716	1	167
β-strand	721-723	3	166
β-strand	727-729	3	167
β-strand	743-745	3	167

Chain C: 17 helices, 30 β-strands

Element	Residues	Length	Sheet
β-strand	12-13	2	107
α-helix	14-23	10
β-strand	28-32	5	108
β-strand	35-37	3	107
β-strand	39	1	109
β-strand	51-55	5	108
β-strand	71-72	2	110
α-helix	73	1
β-strand	79-80	2	110
α-helix	82-84	3
α-helix	112	1
β-strand	113	1	111
α-helix	114-115	2
α-helix	120-122	3
β-strand	123-126	4	112
β-strand	131-135	5	112
β-strand	137	1	113
β-strand	148-150	3	111
β-strand	155-157	3	111
β-strand	162-167	6	112
β-strand	171-205	35	114
β-strand	211-245	35	114
β-strand	248-252	5	112
α-helix	258	1
β-strand	259	1	113
α-helix	260	1
α-helix	261-268	8
α-helix	276-286	11
β-strand	289-296	8	112
β-strand	299-325	27	114
β-strand	329-335	7	115
β-strand	338-344	7	115
β-strand	348-374	27	114
α-helix	379-384	6
α-helix	395-402	8
β-strand	408-415	8	112
α-helix	416-418	3
α-helix	428-445	18
α-helix	452-453	2
β-strand	459-463	5	109
β-strand	466-470	5	109
β-strand	475-476	2	116
β-strand	482-483	2	116
α-helix	488-492	5
α-helix	496-501	6
β-strand	506-507	2	117
β-strand	533-534	2	117

Chain D: 22 helices, 47 β-strands

Element	Residues	Length	Sheet
β-strand	26	1	118
β-strand	29	1	119
α-helix	32-36	5
β-strand	48	1	120
β-strand	54	1	119
β-strand	56	1	121
β-strand	57	1	118
β-strand	69	1	120
α-helix	78-84	7
β-strand	89	1	122
β-strand	97	1	122
α-helix	99-101	3
α-helix	116-118	3
α-helix	126-129	4
α-helix	137-141	5
β-strand	142-144	3	123
β-strand	151-154	4	123
β-strand	156	1	124
β-strand	166-168	3	125
β-strand	177-179	3	125
β-strand	192-198	7	114
β-strand	203-217	15	114
β-strand	226-255	30	114
β-strand	261	1	126
β-strand	272	1	124
α-helix	274-281	8
α-helix	289-299	11
β-strand	302-304	3	123
β-strand	308	1	126
β-strand	313-341	29	114
β-strand	346-373	28	114
β-strand	376-377	2	114
α-helix	385-390	6
α-helix	398-399	2
α-helix	400-412	13
β-strand	421-423	3	123
α-helix	424-427	4
α-helix	434-451	18
α-helix	458-460	3
α-helix	461-463	3
β-strand	465-468	4	127
β-strand	472	1	121
β-strand	473-476	4	127
α-helix	477-478	2
β-strand	482	1	128
β-strand	488	1	128
α-helix	503-506	4
α-helix	509-510	2
α-helix	532-536	5
α-helix	547-550	4
α-helix	551-556	6
β-strand	571	1	129
α-helix	573-575	3
β-strand	580-582	3	130
β-strand	589	1	129
β-strand	594-595	2	131
β-strand	597-599	3	130
β-strand	603-606	4	132
β-strand	611-613	3	131
β-strand	619-620	2	131
β-strand	625-628	4	132
β-strand	631	1	133
β-strand	640-641	2	134
β-strand	649	1	133
β-strand	654-656	3	135
β-strand	658-659	2	134
β-strand	670-672	3	135
β-strand	673	1	136
β-strand	679	1	136

Chain E: 6 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	24-27	4
β-strand	29-37	9	137
α-helix	41-45	5
α-helix	47-49	3
β-strand	53-60	8	137
β-strand	63-72	10	137
β-strand	75-85	11	137
β-strand	91-94	4	137
β-strand	103-110	8	137
β-strand	115-122	8	137
β-strand	125-132	8	137
α-helix	137-138	2
α-helix	139-151	13
α-helix	156-158	3
β-strand	159-161	3	137

Chain F: 13 helices, 30 β-strands

Element	Residues	Length	Sheet
β-strand	10-11	2	138
α-helix	13-20	8
β-strand	26-30	5	139
β-strand	33-35	3	138
α-helix	41-43	3
β-strand	49-53	5	139
β-strand	70-71	2	140
β-strand	78-79	2	140
α-helix	81-83	3
β-strand	114-115	2	141
α-helix	116	1
α-helix	119-123	5
β-strand	124-127	4	142
β-strand	132-136	5	142
β-strand	138	1	143
β-strand	149-150	2	141
β-strand	159-161	3	144
β-strand	166-168	3	144
β-strand	176-177	2	141
β-strand	182-184	3	142
β-strand	187-196	10	114
β-strand	199-218	20	4
β-strand	221-224	4	4
β-strand	231-259	29	4
β-strand	261-269	9	114
β-strand	270-273	4	142
β-strand	280	1	143
α-helix	282-289	8
α-helix	297-307	11
β-strand	310-316	7	142
β-strand	319-323	5	114
β-strand	326-355	30	4
β-strand	359-360	2	4
β-strand	364-391	28	4
α-helix	400-406	7
α-helix	412-422	11
β-strand	428-433	6	142
α-helix	434-436	3
α-helix	447-463	17
α-helix	470-471	2
β-strand	479-481	3	145
β-strand	484-486	3	145
α-helix	512-515	4

Chain G: 15 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	32-34	3
α-helix	84	1
β-strand	85	1	73
α-helix	86	1
β-strand	91	1	73
α-helix	109-111	3
α-helix	160-161	2
β-strand	162	1	74
β-strand	173	1	74
β-strand	178-182	5	4
β-strand	187-222	36	4
β-strand	245-272	28	4
β-strand	275-287	13	4
α-helix	296-303	8
α-helix	311-321	11
β-strand	324-326	3	75
β-strand	328-369	42	4
β-strand	374-404	31	4
β-strand	408	1	4
α-helix	413-423	11
α-helix	432-443	12
β-strand	446-447	2	4
β-strand	452-454	3	75
α-helix	456-458	3
α-helix	460	1
α-helix	466-483	18
α-helix	496	1
β-strand	497-498	2	76
β-strand	501	1	77
β-strand	504	1	77
β-strand	507-508	2	76
α-helix	516-518	3
α-helix	531-533	3

Chain H: 16 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	32-34	3
α-helix	59-60	2
α-helix	84	1
β-strand	85	1	55
α-helix	86	1
β-strand	91	1	55
α-helix	109-111	3
β-strand	162-164	3	56
β-strand	171-173	3	56
β-strand	178-182	5	4
β-strand	187-208	22	4
β-strand	211-213	3	4
β-strand	218-222	5	4
β-strand	245-287	43	4
α-helix	296-303	8
α-helix	311-321	11
β-strand	324-369	46	4
β-strand	374-408	35	4
α-helix	413-423	11
α-helix	432-443	12
β-strand	446-447	2	4
β-strand	451-454	4	4
α-helix	455-457	3
α-helix	460	1
α-helix	466-483	18
α-helix	496	1
β-strand	497-498	2	57
β-strand	501	1	58
β-strand	504	1	58
β-strand	507-508	2	57
α-helix	509-510	2
α-helix	516-518	3
α-helix	531-533	3

15 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Complement component C9	G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X	protein	538	Homo sapiens	P02748 (AlphaFold model)
Complement C5,Complement C5	A	protein	1580	Homo sapiens	P01031 (AlphaFold model)
Complement component C8 beta chain	C	protein	537	Homo sapiens	P07358 (AlphaFold model)
Complement component C7	D	protein	821	Homo sapiens	P10643 (AlphaFold model)
Complement component C8 gamma chain	E	protein	182	Homo sapiens	P07360
Complement component C8 alpha chain	F	protein	554	Homo sapiens	P07357
Complement component C6	B	protein	913	Homo sapiens	P13671

Sequence of entity 1 (G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X), FASTA

>6H04_1 Complement component C9 (chains G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X)
QYTTSYDPELTESSGSASHIDCRMSPWSEWSQCDPCLRQMFRSRSIEVFGQFNGKRCTDA
VGDRRQCVPTEPCEDAEDDCGNDFQCSTGRCIKMRLRCNGDNDCGDFSDEDDCESEPRPP
CRDRVVEESELARTAGYGINILGMDPLSTPFDNEFYNGLCNRDRDGNTLTYYRRPWNVAS
LIYETKGEKNFRTEHYEEQIEAFKSIIQEKTSNFNAAISLKFTPTETNKAEQCCEETASS
ISLHGKGSFRFSYSKNETYQLFLSYSSKKEKMFLHVKGEIHLGRFVMRNRDVVLTTTFVD
DIKALPTTYEKGEYFAFLETYGTHYSSSGSLGGLYELIYVLDKASMKRKGVELKDIKRCL
GYHLDVSLAFSEISVGAEFNKDDCVKRGEGRAVNITSENLIDDVVSLIRGGTRKYAFELK
EKLLRGTVIDVTDFVNWASSINDAPVLISQKLSPIYNLVPVKMKNAHLKKQNLERAIEDY
INEFSVRKCHTCQNGGTVILMDGKCLCACPFKFEGIACEISKQKISEGLPALEFPNEK

Sequence of entity 2 (A), FASTA

>6H04_2 Complement C5,Complement C5 (chains A)
QEQTYVISAPKIFRVGASENIVIQVYGYTEAFDATISIKSYPDKKFSYSSGHVHLSSENK
FQNSAILTIQPKQLPGGQNPVSYVYLEVVSKHFSKSKRMPITYDNGFLFIHTDKPVYTPD
QSVKVRVYSLNDDLKPAKRETVLTFIDPEGSEVDMVEEIDHIGIISFPDFKIPSNPRYGM
WTIKAKYKEDFSTTGTAYFEVKEYVLPHFSVSIEPEYNFIGYKNFKNFEITIKARYFYNK
VVTEADVYITFGIREDLKDDQKEMMQTAMQNTMLINGIAQVTFDSETAVKELSYYSLEDL
NNKYLYIAVTVIESTGGFSEEAEIPGIKYVLSPYKLNLVATPLFLKPGIPYPIKVQVKDS
LDQLVGGVPVTLNAQTIDVNQETSDLDPSKSVTRVDDGVASFVLNLPSGVTVLEFNVKTD
APDLPEENQAREGYRAIAYSSLSQSYLYIDWTDNHKALLVGEHLNIIVTPKSPYIDKITH
YNYLILSKGKIIHFGTREKFSDASYQSINIPVTQNMVPSSRLLVYYIVTGEQTAELVSDS
VWLNIEEKCGNQLQVHLSPDADAYSPGQTVSLNMATGMDSWVALAAVDSAVYGVQRGAKK
PLERVFQFLEKSDLGCGAGGGLNNANVFHLAGLTFLTNANADDSQENDEPCKEILLHMKT
LLPVSKPEIRSYFPESWLWEVHLVPRRKQLQFALPDSLTTWEIQGVGISNTGICVADTVK
AKVFKDVFLEMNIPYSVVRGEQIQLKGTVYNYRTSGMQFCVKMSAVEGICTSESPVIDHQ
GTKSSKCVRQKVEGSSSHLVTFTVLPLEIGLHNINFSLETWFGKEILVKTLRVVPEGVKR
ESYSGVTLDPRGIYGTISRRKEFPYRIPLDLVPKTEIKRILSVKGLLVGEILSAVLSQEG
INILTHLPKGSAEAELMSVVPVFYVFHYLETGNHWNIFHSDPLIEKQKLKKKLKEGMLSI
MSYRNADYSYSVWKGGSASTWLTAFALRVLGQVNKYVEQNQNSICNSLLWLVENYQLDNG
SFKENSQYQPIKLQGTLPVEARENSLYLTAFTVIGIRKAFDICPLVKIDTALIKADNFLL
ENTLPAQSTFTLAISAYALSLGDKTHPQFRSIVSALKREALVKGNPPIYRFWKDNLQHKD
SSVPNTGTARMVETTAYALLTSLNLKDINYVNPVIKWLSEEQRYGGGFYSTQDTINAIEG
LTEYSLLVKQLRLSMDIDVSYKHKGALHNYKMTDKNFLGRPVEVLLNDDLIVSTGFGSGL
ATVHVTTVVHKTSTSEEVCSFYLKIDTQDIEASHYRGYGNSDYKRIVACASYKPSREESS
SGSSHAVMDISLPTGISANEEDLKALVEGVDQLFTDYQIKDGHVILQLNSIPSSDFLCVR
FRIFELFEVGFLSPATFTVYEYHRPDKQCTMFYSTSNIKIQKVCEGAACKCVEADCGQMQ
EELDLTISAETRKQTACKPEIAYAYKVSITSITVENVFVKYKATLLDIYKTGEAVAEKDS
EITFIKKVTCTNAELVKGRQYLIMGKEALQIKYNFSFRYIYPLDSLTWIEYWPRDTTCSS
CQAFLANLDEFAEDIFLNGC

Sequence of entity 3 (C), FASTA

>6H04_3 Complement component C8 beta chain (chains C)
SVDVTLMPIDCELSSWSSWTTCDPCQKKRYRYAYLLQPSQFHGEPCNFSDKEVEDCVTNR
PCRSQVRCEGFVCAQTGRCVNRRLLCNGDNDCGDQSDEANCRRIYKKCQHEMDQYWGIGS
LASGINLFTNSFEGPVLDHRYYAGGCSPHYILNTRFRKPYNVESYTPQTQGKYEFILKEY
ESYSDFERNVTEKMASKSGFSFGFKIPGIFELGISSQSDRGKHYIRRTKRFSHTKSVFLH
ARSDLEVAHYKLKPRSLMLHYEFLQRVKRLPLEYSYGEYRDLFRDFGTHYITEAVLGGIY
EYTLVMNKEAMERGDYTLNNVHACAKNDFKIGGAIEEVYVSLGVSVGKCRGILNEIKDRN
KRDTMVEDLVVLVRGGASEHITTLAYQELPTADLMQEWGDAVQYNPAIIKVKVEPLYELV
TATDFAYSSTVRQNMKQALEEFQKEVSSCHCAPCQGNGVPVLKGSRCDCICPVGSQGLAC
EVSYRKNTPIDGKWNCWSNWSSCSGRRKTRQRQCNNPPPQNGGSPCSGPASETLDCS

Sequence of entity 4 (D), FASTA

>6H04_4 Complement component C7 (chains D)
SSPVNCQWDFYAPWSECNGCTKTQTRRRSVAVYGQYGGQPCVGNAFETQSCEPTRGCPTE
EGCGERFRCFSGQCISKSLVCNGDSDCDEDSADEDRCEDSERRPSCDIDKPPPNIELTGN
GYNELTGQFRNRVINTKSFGGQCRKVFSGDGKDFYRLSGNVLSYTFQVKINNDFNYEFYN
STWSYVKHTSTEHTSSSRKRSFFRSSSSSSRSYTSHTNEIHKGKSYQLLVVENTVEVAQF
INNNPEFLQLAEPFWKELSHLPSLYDYSAYRRLIDQYGTHYLQSGSLGGEYRVLFYVDSE
KLKQNDFNSVEEKKCKSSGWHFVVKFSSHGCKELENALKAASGTQNNVLRGEPFIRGGGA
GFISGLSYLELDNPAGNKRRYSAWAESVTNLPQVIKQKLTPLYELVKEVPCASVKKLYLK
WALEEYLDEFDPCHCRPCQNGGLATVEGTHCLCHCKPYTFGAACEQGVLVGNQAGGVDGG
WSCWSSWSPCVQGKKTRSRECNNPPPSGGGRSCVGETTESTQCEDEELEHLRLLEPHCFP
LSLVPTEFCPSPPALKDGFVQDEGTMFPVGKNVVYTCNEGYSLIGNPVARCGEDLRWLVG
EMHCQKIACVLPVLMDGIQSHPQKPFYTVGEKVTVSCSGGMSLEGPSAFLCGSSLKWSPE
MKNARCVQKENPLTQAVPKCQRWEKLQNSRCVCKMPYECGPSLDVCAQDERSKRILPLTV
CKMHVLHCQGRNYTLTGRDSCTLPASAEKACGACPLWGKCDAESSKCVCREASECEEEGF
SICVEVNGKEQTMSECEAGALRCRGQSISVTSIRPCAAETQ

Sequence of entity 5 (E), FASTA

>6H04_5 Complement component C8 gamma chain (chains E)
QKPQRPRRPASPISTIQPKANFDAQQFAGTWLLVAVGSACRFLQEQGHRAEATTLHVAPQ
GTAMAVSTFRKLDGICWQVRQLYGDTGVLGRFLLQARDARGAVHVVVAETDYQSFAVLYL
ERAGQLSVKLYARSLPVSDSVLSGFEQRVQEAHLTEDQIFYFPKYGFCEAADQFHVLDEV
RR

Sequence of entity 6 (F), FASTA

>6H04_6 Complement component C8 alpha chain (chains F)
AATPAAVTCQLSNWSEWTDCFPCQDKKYRHRSLLQPNKFGGTICSGDIWDQASCSSSTTC
VRQAQCGQDFQCKETGRCLKRHLVCNGDQDCLDGSDEDDCEDVRAIDEDCSQYEPIPGSQ
KAALGYNILTQEDAQSVYDASYYGGQCETVYNGEWRELRYDSTCERLYYGDDEKYFRKPY
NFLKYHFEALADTGISSEFYDNANDLLSKVKKDKSDSFGVTIGIGPAGSPLLVGVGVSHS
QDTSFLNELNKYNEKKFIFTRIFTKVQTAHFKMRKDDIMLDEGMLQSLMELPDQYNYGMY
AKFINDYGTHYITSGSMGGIYEYILVIDKAKMESLGITSRDITTCFGGSLGIQYEDKINV
GGGLSGDHCKKFGGGKTERARKAMAVEDIISRVRGGSSGWSGGLAQNRSTITYRSWGRSL
KYNPVVIDFEMQPIHEVLRHTSLGPLEAKRQNLRRALDQYLMEFNACRCGPCFNNGVPIL
EGTSCRCQCRLGSLGAACEQTQTEGAKADGSWSCWSSWSVCRAGIQERRRECDNPAPQNG
GASCPGRKVQTQAC

Sequence of entity 7 (B), FASTA

>6H04_7 Complement component C6 (chains B)
CFCDHYAWTQWTSCSKTCNSGTQSRHRQIVVDKYYQENFCEQICSKQETRECNWQRCPIN
CLLGDFGPWSDCDPCIEKQSKVRSVLRPSQFGGQPCTAPLVAFQPCIPSKLCKIEEADCK
NKFRCDSGRCIARKLECNGENDCGDNSDERDCGRTKAVCTRKYNPIPSVQLMGNGFHFLA
GEPRGEVLDNSFTGGICKTVKSSRTSNPYRVPANLENVGFEVQTAEDDLKTDFYKDLTSL
GHNENQQGSFSSQGGSSFSVPIFYSSKRSENINHNSAFKQAIQASHKKDSSFIRIHKVMK
VLNFTTKAKDLHLSDVFLKALNHLPLEYNSALYSRIFDDFGTHYFTSGSLGGVYDLLYQF
SSEELKNSGLTEEEAKHCVRIETKKRVLFAKKTKVEHRCTTNKLSEKHEGSFIQGAEKSI
SLIRGGRSEYGAALAWEKGSSGLEEKTFSEWLESVKENPAVIDFELAPIVDLVRNIPCAV
TKRNNLRKALQEYAAKFDPCQCAPCPNNGRPTLSGTECLCVCQSGTYGENCEKQSPDYKS
NAVDGQWGCWSSWSTCDATYKRSRTRECNNPAPQRGGKRCEGEKRQEEDCTFSIMENNGQ
PCINDDEEMKEVDLPEIEADSGCPQPVPPENGFIRNEKQLYLVGEDVEISCLTGFETVGY
QYFRCLPDGTWRQGDVECQRTECIKPVVQEVLTITPFQRLYRIGESIELTCPKGFVVAGP
SRYTCQGNSWTPPISNSLTCEKDTLTKLKGHCQLGQKQSGSECICMSPEEDCSHHSEDLC
VFDTDSNDYFTSPACKFLAEKCLNNQQLHFLHIGSCQDGRQLEWGLERTRLSSNSTKKES
CGYDTCYDWEKCSASTSKCVCLLPPQCFKGGNQLYCVKMGSSTSEKTLNICEVGTIRCAN
RKMEILHPGKCLA

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	38

Primary citation

CryoEM reveals how the complement membrane attack complex ruptures lipid bilayers. Menny, A., Serna, M., Boyd, C.M. et al. Nat Commun (2018) 9:5316-5316. DOI 10.1038/s41467-018-07653-5 · PubMed

Other PDB entries of the same protein (UniProt P02748 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8DE6 3.2 Å, Oligomeric C9 in complex with aE11 Fab
7NYD 3.27 Å, cryoEM structure of 2C9-sMAC
8B0G 3.3 Å, 2C9, C5b9-CD59 structure
8B0H 3.3 Å, 2C9, C5b9-CD59 cryoEM structure
7NYC 3.54 Å, cryoEM structure of 3C9-sMAC
6DLW 3.9 Å, Complement component polyC9
6H03 5.6 Å, Open conformation of the membrane attack complex
5FMW 6.7 Å, The poly-C9 component of the Complement Membrane Attack Complex

Browse structure collections

About this viewer

MolViewer shows 6H04 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.