Intersectin SH3A short isoform. Determined by X-ray diffraction at 1.69 Å resolution. Released 27 Feb 2019.
Explore 6H5T in 3D Show helices and sheets RCSB PDB PDBe
6H5T contains 4 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 738-747 | 10 | 1 |
| β-strand | 751 | 1 | 2 |
| β-strand | 758 | 1 | 1 |
| β-strand | 761 | 1 | 2 |
| β-strand | 766-773 | 8 | 1 |
| β-strand | 779-784 | 6 | 1 |
| β-strand | 787-792 | 6 | 1 |
| α-helix | 793-795 | 3 | |
| β-strand | 796-798 | 3 | 1 |
| α-helix | 799-800 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Intersectin-1 | A, B | protein | 99 | Homo sapiens | Q15811 (AlphaFold model) |
>6H5T_1 Intersectin-1 (chains A, B) GSHMKVVYYRALYPFESRSHDEITIQPGDIVMVDESQTGEPGWLGGELKGKTGWFPANYA EKIPENEVPAPVKPVTDSTSAPAPKLALRETPAPLAVTS
Water and common crystallization additives (ACT, CL) are not listed.
Exon Inclusion Modulates Conformational Plasticity and Autoinhibition of the Intersectin 1 SH3A Domain. Gerth, F., Japel, M., Sticht, J. et al. Structure (2019) 27:977. DOI 10.1016/j.str.2019.03.020 · PubMed
Other PDB entries of the same protein (UniProt Q15811 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6H5T directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.