6H78: E1 enzyme for ubiquitin like protein activation

E1 enzyme for ubiquitin like protein activation. Determined by X-ray diffraction at 2.7 Å resolution. Released 31 Oct 2018.

Method

X-ray diffraction

Resolution

2.7 Å

Organism

Homo sapiens

Chains

16

Atoms

36,069

Mol. weight

545.13 kDa

Ligands

ZN, MG, ATP

Released

31 Oct 2018

Explore 6H78 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6H78 contains 227 α-helices and 227 β-strands across 16 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 13 β-strands

8 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

>6H78_1 Ubiquitin-like modifier-activating enzyme 5 (chains A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P)
GRVRIEKMSSEVVDSNPYSRLMALKRMGIVSDYEKIRTFAVAIVGVGGVGSVTAEMLTRC
GIGKLLLFDYDKVELANMNRLFFQPHQAGLSKVQAAEHTLRNINPDVLFEVHNYNITTVE
NFQHFMDRISNGGLEEGKPVDLVLSCVDNFEARMTINTACNELGQTWMESGVSENAVSGH
IQLIIPGESACFACAPPLVVAANIDEKTLKREGVCAASLPTTMGVVAGILVQNVLKFLLN
FGTVSFYLGYNAMQDFFPTMSMKPNPQCDDRNCRKQQEEYKKKVAALPKQEVIQEEEEII

Ligands and cofactors

Water and common crystallization additives (CL, EDO) are not listed.

Primary citation

An N-Terminal Extension to UBA5 Adenylation Domain Boosts UFM1 Activation: Isoform-Specific Differences in Ubiquitin-like Protein Activation. Soudah, N., Padala, P., Hassouna, F. et al. J Mol Biol (2019) 431:463-478. DOI 10.1016/j.jmb.2018.10.007 · PubMed

Related structures

Other PDB entries of the same protein (UniProt Q9GZZ9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

• 5IAA 1.85 Å, Crystal structure of human UBA5 in complex with UFM1
• 7NW1 1.95 Å, Crystal structure of UFC1 in complex with UBA5
• 3H8V 2.0 Å, Human Ubiquitin-activating Enzyme 5 in Complex with ATP
• 5IA8 2.0 Å, Structure of a Ubiquitin like protein with an E1 fragment
• 5L95 2.1 Å, Crystal structure of human UBA5 in complex with UFM1 and AMP
• 6H77 2.1 Å, E1 enzyme for ubiquitin like protein activation in complex with UBL
• 3GUC 2.25 Å, Human Ubiquitin-activating Enzyme 5 in Complex with AMPPNP
• 5HKH 2.55 Å, Crystal structure of Ufm1 in complex with UBA5
• 7NVK 2.65 Å, Crystal structure of UBA5 fragment fused to the N-terminus of UFC1
• 6H8C Structure of the human GABARAPL2 protein in complex with the UBA5 LIR motif
• 7OVC Structure of the human UFC1 protein in complex with the UBA5 C-terminal UFC1-binding…

Browse structure collections

About this viewer

MolViewer shows 6H78 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.