6HOL: ATG14 LIR motif

Structure of ATG14 LIR motif bound to GABARAPL1. Determined by X-ray diffraction at 1.4 Å resolution. Released 27 Feb 2019.

Method: X-ray diffraction
Resolution: 1.4 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,393
Mol. weight: 33.08 kDa
Released: 27 Feb 2019

Explore 6HOL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6HOL contains 16 α-helices and 18 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 7 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	4-8	5
α-helix	11-24	14
β-strand	28-35	8	1
α-helix	36	1
α-helix	42-44	3
β-strand	48-52	5	1
β-strand	56	1	2
α-helix	57-68	12
β-strand	77-79	3	1
β-strand	80	1	3
β-strand	83	1	3
α-helix	84-86	3
β-strand	90	1	2
α-helix	91-98	8
β-strand	105-110	6	1

Chain C: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
β-strand	1435-1437	3	1
α-helix	1438-1439	2

Chain D: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
β-strand	1436-1437	2	4
α-helix	1438-1439	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Gamma-aminobutyric acid receptor-associated protein-like 1	A, B	protein	123	Homo sapiens	Q9H0R8 (AlphaFold model)
Beclin 1-associated autophagy-related key regulator	C, D	protein	15	Homo sapiens	Q6ZNE5 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6HOL_1 Gamma-aminobutyric acid receptor-associated protein-like 1 (chains A, B)
GPTMGSMKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSD
LTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESV
YGK

Sequence of entity 2 (C, D), FASTA

>6HOL_2 Beclin 1-associated autophagy-related key regulator (chains C, D)
TDLGTDWENLPSPRF

Primary citation

Members of the autophagy class III phosphatidylinositol 3-kinase complex I interact with GABARAP and GABARAPL1 via LIR motifs. Birgisdottir, A.B., Mouilleron, S., Bhujabal, Z. et al. Autophagy (2019) 15:1333-1355. DOI 10.1080/15548627.2019.1581009 · PubMed

Other PDB entries of the same protein (UniProt Q9H0R8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6YOO 1.06 Å, Structure of SAMM50 LIR bound to GABARAPL1
6HOI 1.14 Å, Structure of Beclin1 LIR motif bound to GABARAPL1
5LXI 1.44 Å, GABARAP-L1 ATG4B LIR Complex
7AA7 1.45 Å, Structure of SCOC pS12/pS18 LIR motif bound to GABARAPL1
8X8A 1.53 Å, Crystal structure of STBD1 LIR motif in complex with GABARAPL1
5LXH 1.58 Å, GABARAP-L1 ATG4B LIR Complex
2R2Q 1.65 Å, Crystal structure of human Gamma-Aminobutyric Acid Receptor-Associated Protein-like 1…
7AA9 1.72 Å, Structure of SCOC pT13/pT15 LIR motif bound to GABARAPL1
9JF2 1.76 Å, Crystal structure of GABARAPL1 in complex with ATG16L1
7JHX 1.91 Å, Crystal structure of hEPG5 LIR/GABARAPL1 complex
9HGC 2.52 Å, Crystal structure of human GABARAPL1 in complex with cyclic peptide GAB_D8
5DPT 2.9 Å, Crystal structure of PLEKHM1 LIR-fused human GABARAPL1_2-117

Browse structure collections

About this viewer

MolViewer shows 6HOL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.