6HT5: Oct4/Sox2:UTF1 structure

Oct4/Sox2:UTF1 structure. Determined by X-ray diffraction at 3.45 Å resolution. Released 23 Oct 2019.

Method: X-ray diffraction
Resolution: 3.45 Å
Organism: Mus musculus
Chains: 4
Atoms: 2,287
Mol. weight: 41.14 kDa
Released: 23 Oct 2019

Explore 6HT5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6HT5 contains 9 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain D: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	45-50	6
α-helix	52-67	16
α-helix	73-85	13
α-helix	89-109	21

Chain E: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	134-140	7
α-helix	144-154	11
α-helix	159-170	12
α-helix	176-183	8
α-helix	189-230	42

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA (5'-d(pcpcptpcpaptptpgptptpaptpgpcptpapgptpgpapapg)-3')	A	DNA	22	Mus musculus
DNA (5'-d(tptpcpapcptpapgpcpaptpapapcpapaptpgpapgp*g)-3')	B	DNA	21	Mus musculus
Transcription factor SOX-2	D	protein	83	Mus musculus	P48432 (AlphaFold model)
POU domain, class 5, transcription factor 1	E	protein	154	Mus musculus	P20263 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6HT5_1 DNA (5'-D(P*CP*CP*TP*CP*AP*TP*TP*GP*TP*TP*AP*TP*GP*CP*TP*AP*GP*TP*GP*AP*AP*G)-3') (chains A)
CCTCATTGTTATGCTAGTGAAG

Sequence of entity 2 (B), FASTA

>6HT5_2 DNA (5'-D(*TP*TP*CP*AP*CP*TP*AP*GP*CP*AP*TP*AP*AP*CP*AP*AP*TP*GP*AP*GP*G)-3') (chains B)
TTCACTAGCATAACAATGAGG

Sequence of entity 3 (D), FASTA

>6HT5_3 Transcription factor SOX-2 (chains D)
GAMDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAK
RLRALHMKEHPDYKYRPRRKTKT

Sequence of entity 4 (E), FASTA

>6HT5_4 POU domain, class 5, transcription factor 1 (chains E)
GADMKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTISRFEALQLSLK
NMSKLRPLLEKWVEEADNNENLQEISKSETLVQARKRKRTSIENRVRWSLETMFLKSPKP
SLQQITHIANQLGLEKDVVRVWFSNRRQKGKRSS

Primary citation

Oct4/Sox2:UTF1 structure. Vahokoski, J., Pogenberg, V., Wilmanns, M. To be published.

Other PDB entries of the same protein (UniProt P48432 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8BX1 2.5 Å, Oct4/Sox2 protein:DNA complex
1GT0 2.6 Å, Crystal structure of a POU/HMG/DNA ternary complex
8BX2 3.14 Å, Oct4/Sox2 protein:DNA complex

Browse structure collections

About this viewer

MolViewer shows 6HT5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.