6I3N: Helical MyD88 death domain filament

Helical MyD88 death domain filament. Determined by electron microscopy at 3.1 Å resolution. Released 20 Nov 2019.

Method: Electron microscopy
Resolution: 3.1 Å
Organism: Homo sapiens
Chains: 13
Atoms: 10,660
Mol. weight: 229.41 kDa
Released: 20 Nov 2019

Explore 6I3N in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6I3N contains 104 α-helices and 0 β-strands across 13 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, C, D, E, F, G, H, I, J, K, L and M: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	22-24	3
α-helix	27-37	11
α-helix	47-53	7
α-helix	58-64	7
α-helix	70-77	8
α-helix	86-95	10
α-helix	100-104	5
α-helix	106-120	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Myeloid differentiation primary response protein MyD88	A, B, C, D, E, F, G, H, I, J, K, L, M	protein	162	Homo sapiens	Q99836 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G, H, I, J, K, L, M), FASTA

>6I3N_1 Myeloid differentiation primary response protein MyD88 (chains A, B, C, D, E, F, G, H, I, J, K, L, M)
SNAMAAGGPGAGSAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADWTALAEEMDFE
YLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYI
LKQQQEEAEKPLQVAAVDSSVPRTAELAGITTLDWSHPQFEK

Primary citation

MyD88 Death-Domain Oligomerization Determines Myddosome Architecture: Implications for Toll-like Receptor Signaling. Moncrieffe, M.C., Bollschweiler, D., Li, B. et al. Structure (2020) 28:281-289.e3. DOI 10.1016/j.str.2020.01.003 · PubMed

Other PDB entries of the same protein (UniProt Q99836 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4EO7 1.45 Å, Crystal structure of the TIR domain of human myeloid differentiation primary response…
9HFV 1.45 Å, MyD88 peptide_2 bound to SPOP MATH domain
4DOM 1.8 Å, Crystal Structure of the TIR-domain of Human Myeloid Differentiation Primary Response…
9HGH 1.9 Å, MyD88 peptide_1 bound to SPOP MATH domain
7BER 2.3 Å, SFX structure of the MyD88 TIR domain higher-order assembly (solved, rebuilt and refined…
7L6W 2.3 Å, SFX structure of the MyD88 TIR domain higher-order assembly
8S78 2.85 Å, MicroED Structure of TLR2 TIR domain-induced MyD88 TIR domain higher-order assembly
7BEQ 3.0 Å, MicroED structure of the MyD88 TIR domain higher-order assembly
8W8M 3.28 Å, Cryo-EM structure of helical filament of MyD88 TIR
8YYM 3.3 Å, Cryo-EM structure of cylindrical fiber of MyD88 TIR
3MOP 3.4 Å, The ternary Death Domain complex of MyD88, IRAK4, and IRAK2
2JS7 Solution NMR structure of human myeloid differentiation primary response (MyD88).…

Browse structure collections

About this viewer

MolViewer shows 6I3N directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.