8S78: PDB entry 8S78

MicroED Structure of TLR2 TIR domain-induced MyD88 TIR domain higher-order assembly. Determined by electron crystallography at 2.85 Å resolution. Released 5 Feb 2025.

Method: Electron crystallography
Resolution: 2.85 Å
Organism: Escherichia coli BL21(DE3)
Chains: 1
Atoms: 1,133
Mol. weight: 17.83 kDa
Released: 5 Feb 2025

Explore 8S78 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8S78 contains 10 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	161-165	5	1
β-strand	166	1	2
α-helix	169-171	3
α-helix	172-178	7
α-helix	179-183	5
β-strand	191-193	3	1
α-helix	194-197	4
α-helix	199	1
α-helix	211-215	5
β-strand	216-218	3	1
β-strand	219-223	5	2
α-helix	225-228	4
α-helix	231-243	13
β-strand	252-256	5	2
α-helix	272-273	2
β-strand	274-275	2	2
α-helix	282-294	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Myeloid differentiation primary response protein MyD88	A	protein	151	Escherichia coli BL21(DE3)	Q99836 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8S78_1 Myeloid differentiation primary response protein MyD88 (chains A)
MGHMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIE
KRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRFITV
CDYTNPCTKSWFWTRLAKALSLPLEHHHHHH

Primary citation

Microcrystal electron diffraction structure of Toll-like receptor 2 TIR-domain-nucleated MyD88 TIR-domain higher-order assembly. Li, Y., Pacoste, L.C., Gu, W. et al. Acta Crystallogr D Struct Biol (2024) 80:699-712. DOI 10.1107/S2059798324008210 · PubMed

Other PDB entries of the same protein (UniProt Q99836 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4EO7 1.45 Å, Crystal structure of the TIR domain of human myeloid differentiation primary response…
9HFV 1.45 Å, MyD88 peptide_2 bound to SPOP MATH domain
4DOM 1.8 Å, Crystal Structure of the TIR-domain of Human Myeloid Differentiation Primary Response…
9HGH 1.9 Å, MyD88 peptide_1 bound to SPOP MATH domain
7BER 2.3 Å, SFX structure of the MyD88 TIR domain higher-order assembly (solved, rebuilt and refined…
7L6W 2.3 Å, SFX structure of the MyD88 TIR domain higher-order assembly
7BEQ 3.0 Å, MicroED structure of the MyD88 TIR domain higher-order assembly
6I3N 3.1 Å, Helical MyD88 death domain filament
8W8M 3.28 Å, Cryo-EM structure of helical filament of MyD88 TIR
8YYM 3.3 Å, Cryo-EM structure of cylindrical fiber of MyD88 TIR
3MOP 3.4 Å, The ternary Death Domain complex of MyD88, IRAK4, and IRAK2
2JS7 Solution NMR structure of human myeloid differentiation primary response (MyD88).…

Browse structure collections

About this viewer

MolViewer shows 8S78 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.