Crystal Structure of Plasmodium falciparum actin I in the Mg-K-ATP/ADP state. Determined by X-ray diffraction at 1.24 Å resolution. Released 26 Jun 2019.
Explore 6I4D in 3D Show helices and sheets RCSB PDB PDBe
6I4D contains 30 α-helices and 24 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 6-8 | 3 | |
| β-strand | 9-13 | 5 | 1 |
| β-strand | 17-22 | 6 | 1 |
| β-strand | 30-33 | 4 | 1 |
| β-strand | 36-39 | 4 | 2 |
| β-strand | 54-55 | 2 | 2 |
| α-helix | 57-61 | 5 | |
| α-helix | 63-65 | 3 | |
| β-strand | 66-69 | 4 | 2 |
| α-helix | 73-75 | 3 | |
| α-helix | 80-89 | 10 | |
| α-helix | 90-95 | 6 | |
| α-helix | 99-101 | 3 | |
| β-strand | 104-108 | 5 | 1 |
| α-helix | 114-126 | 13 | |
| β-strand | 132-137 | 6 | 1 |
| α-helix | 138-145 | 8 | |
| β-strand | 151-156 | 6 | 3 |
| β-strand | 161-167 | 7 | 3 |
| β-strand | 170-171 | 2 | 3 |
| α-helix | 173-175 | 3 | |
| β-strand | 177-179 | 3 | 3 |
| α-helix | 183-193 | 11 | |
| α-helix | 194-197 | 4 | |
| α-helix | 204-217 | 14 | |
| α-helix | 224-232 | 9 | |
| β-strand | 239-242 | 4 | 4 |
| β-strand | 248-251 | 4 | 4 |
| α-helix | 254-260 | 7 | |
| α-helix | 265-268 | 4 | |
| α-helix | 275-284 | 10 | |
| α-helix | 291-295 | 5 | |
| β-strand | 298-301 | 4 | 3 |
| α-helix | 303-305 | 3 | |
| α-helix | 310-321 | 12 | |
| β-strand | 330-331 | 2 | 3 |
| α-helix | 336-338 | 3 | |
| α-helix | 339-349 | 11 | |
| α-helix | 353-355 | 3 | |
| β-strand | 358-359 | 2 | 1 |
| α-helix | 360-365 | 6 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 6-10 | 5 | |
| β-strand | 16-23 | 8 | 5 |
| β-strand | 26-29 | 4 | 5 |
| α-helix | 30-31 | 2 | |
| α-helix | 32-34 | 3 | |
| β-strand | 37-39 | 3 | 6 |
| β-strand | 43-51 | 9 | 5 |
| β-strand | 57-65 | 9 | 5 |
| α-helix | 71-87 | 17 | |
| β-strand | 92-98 | 7 | 5 |
| α-helix | 104-107 | 4 | |
| β-strand | 115-117 | 3 | 6 |
| α-helix | 121-123 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Actin-1 | A | protein | 378 | Plasmodium falciparum | Q8I4X0 (AlphaFold model) |
| Gelsolin | G | protein | 127 | Mus musculus | P13020 (AlphaFold model) |
>6I4D_1 Actin-1 (chains A) GAMGEEDVQALVVDNGSGNVKAGVAGDDAPRSVFPSIVGRPKNPGIMVGMEEKDAFVGDE AQTKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRAAPEEHPVLLTEAPLNPKGNRE RMTQIMFESFNVPAMYVAIQAVLSLYSSGRTTGIVLDSGDGVSHTVPIYEGYALPHAIMR LDLAGRDLTEYLMKILHERGYGFSTSAEKEIVRDIKEKLCYIALNFDEEMKTSEQSSDIE KSYELPDGNIITVGNERFRCPEALFQPSFLGKEAAGIHTTTFNSIKKCDVDIRKDLYGNI VLSGGTTMYEGIGERLTRDITTLAPSTMKIKVVAPPERKYSVWIGGSILSSLSTFQQMWI TKEEYDESGPSIVHRKCF
>6I4D_2 Gelsolin (chains G) GPMVVEHPEFLKAGKEPGLQIWRVEKFDLVPVPPNLYGDFFTGDAYVILKTVQLRQGQLQ YDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESSTFSGYFKSGLKYKK GGVASGF
| ID | Name | Formula | Copies |
|---|---|---|---|
| BTB | 2-[bis-(2-hydroxy-ethyl)-amino]-2-hydroxymethyl-propane-1,3-diol | C8 H19 N O5 | 1 |
| SCN | Thiocyanate ion | C N S | 2 |
| MG | Magnesium ion | Mg | 1 |
| ADP | Adenosine-5'-diphosphate | C10 H15 N5 O10 P2 | 1 |
| ATP | Adenosine-5'-triphosphate | C10 H16 N5 O13 P3 | 1 |
| CA | Calcium ion | Ca | 2 |
Water and common crystallization additives (CL, K) are not listed.
Atomic view into Plasmodium actin polymerization, ATP hydrolysis, and fragmentation. Kumpula, E.P., Lopez, A.J., Tajedin, L. et al. PLoS Biol (2019) 17:e3000315-e3000315. DOI 10.1371/journal.pbio.3000315 · PubMed
Other PDB entries of the same protein (UniProt Q8I4X0 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6I4D directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.