6I4X: SOCS2:Elongin C:Elongin B

Crystal structure of SOCS2:Elongin C:Elongin B in complex with erythropoietin receptor peptide. Determined by X-ray diffraction at 2.69 Å resolution. Released 29 May 2019.

Method: X-ray diffraction
Resolution: 2.69 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,782
Mol. weight: 43.46 kDa
Released: 29 May 2019

Explore 6I4X in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6I4X contains 18 α-helices and 26 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	32-46	15
β-strand	49	1	6
α-helix	55-61	7
α-helix	66	1
β-strand	70-74	5	6
β-strand	82-88	7	6
β-strand	91-100	10	6
β-strand	103-106	4	6
β-strand	108	1	7
β-strand	119	1	6
α-helix	122-132	11
β-strand	155	1	6
α-helix	160-162	3
α-helix	163-172	10
α-helix	185-192	8

Chain B: 6 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	2-9	8	1
β-strand	10	1	2
β-strand	12-19	8	1
β-strand	23	1	3
α-helix	24-35	12
α-helix	39-41	3
β-strand	42-46	5	1
β-strand	49-50	2	1
β-strand	56	1	3
β-strand	68	1	4
β-strand	71	1	4
α-helix	72	1
β-strand	73-79	7	1
β-strand	80-81	2	5
β-strand	84-85	2	5
α-helix	86-87	2
β-strand	90	1	2
α-helix	91-94	4
α-helix	98-100	3

Chain C: 5 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	18-22	5	1
β-strand	28-32	5	1
α-helix	33-36	4
α-helix	40-44	5
β-strand	59-61	3	1
α-helix	67-82	16
α-helix	89-92	4
α-helix	97-110	14

Chain D: 0 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	0	1	6
β-strand	3	1	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Elongin-B	B	protein	104	Homo sapiens	Q15370 (AlphaFold model)
Elongin-C	C	protein	97	Homo sapiens	Q15369 (AlphaFold model)
Suppressor of cytokine signaling 2	A	protein	169	Homo sapiens	O14508 (AlphaFold model)
Erythropoietin receptor	D	protein	11	Homo sapiens

Sequence of entity 1 (B), FASTA

>6I4X_1 Elongin-B (chains B)
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEC
GFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMK

Sequence of entity 2 (C), FASTA

>6I4X_2 Elongin-C (chains C)
MMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCM
YFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC

Sequence of entity 3 (A), FASTA

>6I4X_3 Suppressor of cytokine signaling 2 (chains A)
SMQAARLAKALRELGQTGWYWGSMTVNEAKEKLKEAPEGTFLIRDSSHSDYLLTISVKTS
AGPTNLRIEYQDGKFRLDSIICVKSALAAFDSVVHLIDYYVQMCKDKRTGPEAPRNGTVH
LYLTKPLYTSAPSLQHLCRLTINKCTGAIWGLPLPTRLKDYLEEYKFQV

Sequence of entity 4 (D), FASTA

>6I4X_4 Erythropoietin receptor (chains D)
ASFEYTILDPS

Primary citation

Structural insights into substrate recognition by the SOCS2 E3 ubiquitin ligase. Kung, W.W., Ramachandran, S., Makukhin, N. et al. Nat Commun (2019) 10:2534-2534. DOI 10.1038/s41467-019-10190-4 · PubMed

Other PDB entries of the same protein (UniProt Q15370 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7Z76 1.32 Å, Crystal structure of compound 10 in complex with the bromodomain of human SMARCA2 and…
9GIO 1.49 Å, Crystal structure of the VHL-EloC-EloB complex with a covalent compound bound to C77 of…
7JTO 1.7 Å, Crystal structure of Protac MS33 in complex with the WD repeat-containing protein 5 and…
8BDS 1.72 Å, Ternary complex between VCB, BRD4-BD1 and PROTAC 48
4AJY 1.73 Å, von Hippel-Lindau protein-ElonginB-ElonginC complex, bound to Hif1- alpha peptide
6GMR 1.75 Å, pVHL:EloB:EloC in complex with (4-(1H-pyrrol-1-yl)phenyl)methanol
6HR2 1.76 Å, Crystal structure of PROTAC 2 in complex with the bromodomain of human SMARCA4 and…
7ZLM 1.79 Å, Crystal structure of SOCS2:ElonginB:ElonginC in complex with compound MN551
6I7Q 1.8 Å, Structure of pVHL-elongin B-elongin C (VCB) in complex with hydroxylated-HIF-2alpha…
8BB3 1.8 Å, Structure of human WDR5 and pVHL:ElonginC:ElonginB bound to PROTAC with PEG linker…
6GFX 1.83 Å, pVHL:EloB:EloC in complex with modified HIF-1a CODD peptide containing…
1LM8 1.85 Å, Structure of a HIF-1a-pVHL-ElonginB-ElonginC Complex

Browse structure collections

About this viewer

MolViewer shows 6I4X directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.