Circular permutant of ribosomal protein S6, adding 9aa to N terminal of P81-82, L75A mutant. Determined by X-ray diffraction at 1.57 Å resolution. Released 27 Nov 2019.
Explore 6I6U in 3D Show helices and sheets RCSB PDB PDBe
6I6U contains 6 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 13-20 | 8 | 1 |
| β-strand | 26-33 | 8 | 1 |
| α-helix | 39-55 | 17 | |
| α-helix | 58 | 1 | |
| β-strand | 59-75 | 17 | 1 |
| β-strand | 78-89 | 12 | 1 |
| α-helix | 92-101 | 10 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 2-10 | 9 | |
| β-strand | 13-20 | 8 | 1 |
| β-strand | 26-33 | 8 | 1 |
| α-helix | 39-55 | 17 | |
| β-strand | 59-75 | 17 | 1 |
| β-strand | 78-89 | 12 | 1 |
| α-helix | 92-103 | 12 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| 30S ribosomal protein S6,30S ribosomal protein S6 | A, B | protein | 105 | Thermus thermophilus HB8 | Q5SLP8 (AlphaFold model) |
>6I6U_1 30S ribosomal protein S6,30S ribosomal protein S6 (chains A, B) MNDAARELRIRDNVRRVMVVASTTPGRYEVNIVLNPNLDQSQLALEKEIIQRALENYGAR VEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRI
Exposing the distinctive modular behavior of beta-strands and alpha-helices in folded proteins. Wang, H., Logan, D.T., Danielsson, J. et al. Proc Natl Acad Sci U S A (2020) 117:28775-28783. DOI 10.1073/pnas.1920455117 · PubMed
Other PDB entries of the same protein (UniProt Q5SLP8 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6I6U directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.