6I7D: Myosin-A

Plasmodium falciparum Myosin A, post-rigor and rigor-like states. Determined by X-ray diffraction at 2.82 Å resolution. Released 7 Aug 2019.

Method: X-ray diffraction
Resolution: 2.82 Å
Organism: Plasmodium falciparum
Chains: 4
Atoms: 24,354
Mol. weight: 346.49 kDa
Released: 7 Aug 2019

Explore 6I7D in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6I7D contains 149 α-helices and 115 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 36 helices, 29 β-strands

Element	Residues	Length	Sheet
α-helix	5-14	10
α-helix	20-21	2
β-strand	24	1	1
β-strand	30	1	1
β-strand	35-38	4	2
α-helix	42-46	5
β-strand	53-57	5	2
α-helix	58	1
β-strand	66-72	7	2
β-strand	80-82	3	2
α-helix	84-86	3
β-strand	87-89	3	2
β-strand	101	1	3
α-helix	102-104	3
α-helix	110-122	13
β-strand	127-130	4	3
β-strand	133-137	5	3
α-helix	148-156	9
α-helix	160-162	3
α-helix	164-165	2
α-helix	167-181	15
β-strand	185-191	7	3
α-helix	197-209	13
α-helix	219-235	17
β-strand	236-237	2	4
β-strand	245-246	2	4
β-strand	249-256	8	3
β-strand	262-270	9	3
α-helix	275-278	4
β-strand	287	1	4
α-helix	288-296	9
α-helix	299-304	6
α-helix	328-340	13
α-helix	346-363	18
β-strand	367-372	6	5
β-strand	375-381	7	5
α-helix	383-385	3
α-helix	386-395	10
α-helix	400-408	9
β-strand	409-412	4	6
β-strand	419-422	4	6
β-strand	424	1	5
α-helix	425-455	31
β-strand	465-471	7	3
α-helix	481-512	32
α-helix	525-532	8
α-helix	538-547	10
α-helix	553-563	11
β-strand	570-572	3	7
β-strand	580-585	6	7
β-strand	588-593	6	7
α-helix	597-601	5
α-helix	608-614	7
α-helix	619-624	6
α-helix	637-639	3
α-helix	641-657	17
β-strand	660-667	8	3
α-helix	680-689	10
α-helix	692-699	8
β-strand	705-708	4	8
α-helix	709-714	6
α-helix	728-741	14
β-strand	749-751	3	8
β-strand	755-758	4	8
α-helix	760-767	8

Chain B: 40 helices, 29 β-strands

Element	Residues	Length	Sheet
α-helix	5-14	10
α-helix	20-21	2
β-strand	24	1	9
α-helix	29	1
β-strand	30	1	9
α-helix	31	1
β-strand	35-38	4	10
α-helix	42-46	5
β-strand	53-57	5	10
α-helix	58	1
β-strand	66-72	7	10
β-strand	80-82	3	10
α-helix	84-86	3
β-strand	87-89	3	10
β-strand	101	1	11
α-helix	102-104	3
α-helix	110-122	13
β-strand	127-130	4	11
β-strand	133-137	5	11
α-helix	148-156	9
α-helix	160-162	3
α-helix	164-165	2
α-helix	167-181	15
β-strand	185-191	7	11
α-helix	197-209	13
α-helix	219-235	17
β-strand	236-237	2	12
β-strand	245-246	2	12
β-strand	249-256	8	11
β-strand	262-270	9	11
α-helix	275-278	4
β-strand	287	1	12
α-helix	288-296	9
α-helix	299-305	7
α-helix	328-340	13
α-helix	346-363	18
α-helix	365-366	2
β-strand	367-372	6	13
β-strand	375-381	7	13
α-helix	383-385	3
α-helix	386-395	10
α-helix	400-408	9
β-strand	409-413	5	14
β-strand	418-422	5	14
β-strand	424	1	13
α-helix	425-455	31
β-strand	465-471	7	11
α-helix	481-512	32
α-helix	525-532	8
α-helix	538-547	10
α-helix	553-563	11
β-strand	570-572	3	15
β-strand	580-585	6	15
β-strand	588-593	6	15
α-helix	597-601	5
α-helix	608-614	7
α-helix	619-624	6
α-helix	637-639	3
α-helix	641-657	17
β-strand	660-667	8	11
α-helix	680-689	10
α-helix	692-699	8
β-strand	703-708	6	16
α-helix	709-712	4
α-helix	713-715	3
α-helix	729-741	13
β-strand	749-751	3	16
β-strand	755-759	5	16
α-helix	760-765	6

Chain C: 36 helices, 28 β-strands

Element	Residues	Length	Sheet
α-helix	5-14	10
α-helix	20-21	2
β-strand	24	1	17
β-strand	30	1	17
β-strand	35-38	4	18
α-helix	42-46	5
β-strand	53-57	5	18
α-helix	58	1
β-strand	66-72	7	18
β-strand	80-82	3	18
α-helix	84-86	3
β-strand	87-89	3	18
β-strand	101	1	19
α-helix	102-104	3
α-helix	110-122	13
β-strand	127-130	4	19
β-strand	133-137	5	19
α-helix	148-156	9
α-helix	160-162	3
α-helix	164-165	2
α-helix	167-181	15
β-strand	185-191	7	19
α-helix	197-209	13
α-helix	219-235	17
β-strand	236-237	2	20
β-strand	245-246	2	20
β-strand	249-256	8	19
β-strand	262-270	9	19
α-helix	275-278	4
β-strand	287	1	20
α-helix	288-296	9
α-helix	299-304	6
α-helix	328-340	13
α-helix	346-363	18
β-strand	367-368	2	21
β-strand	380-381	2	21
α-helix	386-395	10
α-helix	400-408	9
β-strand	409-410	2	22
β-strand	421-422	2	22
α-helix	425-455	31
β-strand	465-471	7	19
α-helix	481-512	32
α-helix	525-532	8
α-helix	538-547	10
α-helix	553-563	11
β-strand	570-572	3	23
β-strand	580-585	6	23
β-strand	588-593	6	23
α-helix	597-601	5
α-helix	607-614	8
α-helix	619-624	6
α-helix	637-639	3
α-helix	641-657	17
β-strand	660-667	8	19
α-helix	680-689	10
α-helix	692-699	8
β-strand	705-708	4	24
α-helix	709-716	8
α-helix	721-724	4
α-helix	731-742	12
β-strand	749-750	2	24
β-strand	755-758	4	24
α-helix	762-767	6

Chain D: 37 helices, 29 β-strands

Element	Residues	Length	Sheet
α-helix	5-14	10
α-helix	20-22	3
β-strand	25	1	25
β-strand	29-30	2	25
β-strand	35-38	4	26
α-helix	42-46	5
β-strand	53-57	5	26
α-helix	58	1
β-strand	66-72	7	26
β-strand	80-82	3	26
α-helix	84-86	3
β-strand	88-89	2	26
β-strand	101	1	27
α-helix	102-104	3
α-helix	110-122	13
β-strand	127-130	4	27
β-strand	133-137	5	27
α-helix	148-156	9
α-helix	164-165	2
α-helix	167-180	14
β-strand	185-191	7	27
α-helix	197-209	13
α-helix	220-235	16
β-strand	236-237	2	28
β-strand	245-246	2	28
β-strand	249-256	8	27
β-strand	262-270	9	27
α-helix	275-278	4
β-strand	287	1	28
α-helix	288-296	9
α-helix	299-304	6
α-helix	329-340	12
α-helix	346-363	18
α-helix	365-366	2
β-strand	367-370	4	29
β-strand	378-381	4	29
α-helix	383-385	3
α-helix	386-395	10
α-helix	400-408	9
β-strand	409-413	5	30
β-strand	418-422	5	30
β-strand	424	1	29
α-helix	425-453	29
β-strand	465-470	6	27
α-helix	481-512	32
α-helix	520-522	3
α-helix	525-532	8
α-helix	538-547	10
α-helix	553-563	11
β-strand	570-572	3	31
β-strand	580-585	6	31
β-strand	588-593	6	31
α-helix	597-601	5
α-helix	607-614	8
α-helix	619-624	6
α-helix	641-657	17
β-strand	660-667	8	27
α-helix	680-689	10
α-helix	692-700	9
β-strand	705-708	4	32
α-helix	709-715	7
α-helix	721-724	4
α-helix	731-741	11
β-strand	749-750	2	32
β-strand	755-758	4	32
α-helix	760-765	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Myosin-A	A, B, C, D	protein	768	Plasmodium falciparum	Q8IDR3 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>6I7D_1 Myosin-A (chains A, B, C, D)
MAVTNEEIKTASKIVRRVSNVEAFDKSGSVFKGYQIWTDISPTIENDPNIMFVKCVVQQG
SKKEKLTVVQIDPPGTGTPYDIDPTHAWNCNSQVDPMSFGDIGLLNHTNIPCVLDFLKHR
YLKNQIYTTAVPLIVAINPYKDLGNTTNEWIRRYRDTADHTKLPPHVFTCAREALSNLHG
VNKSQTIIVSGESGAGKTEATKQIMRYFASSKSGNMDLRIQTAIMAANPVLEAFGNAKTI
RNNNSSRFGRFMQLVISHEGGIRYGSVVAFLLEKSRIITQDDNERSYHIFYQFLKGANST
MKSKFGLKGVTEYKLLNPNSTEVSGVDDVKDFEEVIESLKNMELSESDIEVIFSIVAGIL
TLGNVRLIEKQEAGLSDAAAIMDEDMGVFNKACELMYLDPELIKREILIKVTVAGGTKIE
GRWNKNDAEVLKSSLCKAMYEKLFLWIIRHLNSRIEPEGGFKTFMGMLDIFGFEVFKNNS
LEQLFINITNEMLQKNFVDIVFERESKLYKDEGISTAELKYTSNKEVINVLCEKGKSVLS
YLEDQCLAPGGTDEKFVSSCATNLKENNKFTPAKVASNKNFIIQHTIGPIQYCAESFLLK
NKDVLRGDLVEVIKDSPNPIVQQLFEGQVIEKGKIAKGSLIGSQFLNQLTSLMNLINSTE
PHFIRCIKPNENKKPLEWCEPKILIQLHALSILEALVLRQLGYSYRRTFEEFLYQYKFVD
IAAAEDSSVENQNKCVNILKLSGLSESMYKIGKSMVFLKQEGAKILTK

Primary citation

Plasmodium myosin A drives parasite invasion by an atypical force generating mechanism. Robert-Paganin, J., Robblee, J.P., Auguin, D. et al. Nat Commun (2019) 10:3286-3286. DOI 10.1038/s41467-019-11120-0 · PubMed

Other PDB entries of the same protein (UniProt Q8IDR3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4MZJ 1.47 Å, Crystal Structure of MTIP from Plasmodium falciparum in complex with pGly[801,805], a…
4MZK 1.82 Å, Crystal Structure of MTIP from Plasmodium falciparum in complex with pGly[807,811], a…
4AOM 1.94 Å, MTIP and MyoA complex
4R1E 1.98 Å, Crystal Structure of MTIP from Plasmodium falciparum in complex with a peptide-fragment…
4MZL 2.01 Å, Crystal Structure of MTIP from Plasmodium falciparum in complex with HBS myoA, a…
8A12 2.03 Å, Plasmodium falciparum Myosin A full-length, post-rigor state complexed to Mg.ATP-gamma-S
8CDQ 2.21 Å, Plasmodium falciparum Myosin A full-length, post-rigor state complexed to the inhibitor…
8CDM 2.35 Å, Plasmodium falciparum Myosin A full-length, post-rigor state complexed to the inhibitor…
9T7I 2.35 Å, Plasmodium falciparum Myosin A full-length, post-rigor state, complexed to the inhibitor…
6ZN3 2.51 Å, Plasmodium facliparum glideosome trimeric sub-complex
6YCY 2.55 Å, Plasmodium falciparum Myosin A full-length, post-rigor state
6TU7 3.1 Å, Structure of PfMyoA decorated Plasmodium Act1 filament

Browse structure collections

About this viewer

MolViewer shows 6I7D directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.