6J62: MISG15/NS1B complex

Crystal structure of mISG15/NS1B complex. Determined by X-ray diffraction at 2.49 Å resolution. Released 25 Dec 2019.

Method: X-ray diffraction
Resolution: 2.49 Å
Organisms: Mus musculus, Influenza B virus (strain B/Lee/1940)
Chains: 2
Atoms: 1,925
Mol. weight: 29.16 kDa
Released: 25 Dec 2019

Explore 6J62 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6J62 contains 9 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	3-9	7	1
β-strand	14-19	6	1
β-strand	24	1	2
α-helix	25-36	12
α-helix	40-42	3
β-strand	43-47	5	1
β-strand	50-51	2	1
β-strand	57	1	2
β-strand	68-73	6	1
β-strand	80-85	6	3
β-strand	91-96	6	3
β-strand	101	1	4
α-helix	102-113	12
α-helix	117-119	3
β-strand	120-124	5	3
β-strand	127-129	3	3
β-strand	134	1	4
α-helix	135-138	4
β-strand	145-150	6	3

Chain C: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	16-36	21
α-helix	42-62	21
α-helix	68-70	3
α-helix	74-90	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ubiquitin-like protein ISG15	A	protein	153	Mus musculus	Q64339 (AlphaFold model)
Non-structural protein 1	C	protein	103	Influenza B virus (strain B/Lee/1940)	P03502 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6J62_1 Ubiquitin-like protein ISG15 (chains A)
MAWDLKVKMLGGNDFLVSVTNSMTVSELKKQIAQKIGVPAFQQRLAHQTAVLQDGLTLSS
LGLGPSSTVMLVVQNCSEPLSILVRNERGHSNIYEVFLTQTVDTLKKKVSQREQVHEDQF
WLSFEGRPMEDKELLGEYGLKPQCTVIKHLRLR

Sequence of entity 2 (C), FASTA

>6J62_2 Non-structural protein 1 (chains C)
MADNMTTTQIEVGPGATNATINFEAGILECYERFSWQRALDYPGQDRLHRLKRKLESRIK
THNKSEPENKRMSLEERKAIGVKMMKVLLFMDPSAGIEGFEPY

Primary citation

Crystal structure of mISG15/NS1B complex. Jiang, Y.N., Wang, X.Q. To be published.

Other PDB entries of the same protein (UniProt Q64339 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5CHW 2.1 Å, Structure of ISG15 in space group P212121
5CHF 2.3 Å, Crystal structure of murine ISG15 in space group P21212
5TL7 2.44 Å, Crystal structure of SARS-CoV papain-like protease in complex with C-terminal domain…
5JZE 2.47 Å, Erve virus viral OTU domain protease in complex with mouse ISG15
5CHV 3.0 Å, Crystal structure of USP18-ISG15 complex
6YVA 3.18 Å, PLpro-C111S with mISG15
5TLA 3.24 Å, Crystal structure of mouse ISG15

Browse structure collections

About this viewer

MolViewer shows 6J62 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.