6J8O: Hypothetical protease

Structure of a hypothetical protease. Determined by X-ray diffraction at 1.85 Å resolution. Released 22 Jan 2020.

Method: X-ray diffraction
Resolution: 1.85 Å
Organism: Homo sapiens
Chains: 3
Atoms: 2,607
Mol. weight: 34.26 kDa
Released: 22 Jan 2020

Explore 6J8O in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6J8O contains 13 α-helices and 11 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	20-47	28

Chain B: 12 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	71-84	14
α-helix	88-95	8
α-helix	101-110	10
α-helix	118-132	15
β-strand	134	1	1
β-strand	149	1	2
α-helix	150-163	14
β-strand	167	1	1
α-helix	169-180	12
β-strand	186-197	12	3
β-strand	200-211	12	3
β-strand	214-218	5	3
α-helix	224-226	3
β-strand	229-233	5	3
α-helix	236-249	14
α-helix	252	1
β-strand	253-259	7	3
α-helix	261-264	4
β-strand	272	1	2
α-helix	273	1
β-strand	278-281	4	3
α-helix	282-302	21

Chain C: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	449-450	2	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Small vasohibin-binding protein	A	protein	49	Homo sapiens	Q8N300 (AlphaFold model)
Tubulinyl-Tyr carboxypeptidase 1	B	protein	238	Homo sapiens	Q7L8A9 (AlphaFold model)
8-mer peptide	C	protein	8	Homo sapiens	P68363 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6J8O_1 Small vasohibin-binding protein (chains A)
GSPPARKEKTKVKESVSRVEKAKQKSAQQELKQRQRAEIYALNRVMTEL

Sequence of entity 2 (B), FASTA

>6J8O_2 Tubulinyl-Tyr carboxypeptidase 1 (chains B)
MDEATWERMWKHVAKIHPDGEKVAQRIRGATDLPKIPIPSVPTFQPSTPVPERLEAVQRY
IRELQYNHTGTQFFEIKKSRPLTGLMDLAKEMTKEALPIKSLEAVILGIYLTNSMPTLER
FPISFKTYFSGNYFRHIVLGVNFAGRYGALGMSRREDLMYKPPAFRTLSELVLDFEAAYG
RCWHVLKKVKLGQSVSHDPHSVEQIEWKHSVLDVERLGRDDFRKELERHARDMRLKIG

Sequence of entity 3 (C), FASTA

>6J8O_3 8-mer peptide (chains C)
GEEEGEEY

Primary citation

Structure of a hypothetical protease. Liao, S., Gao, J., Xu, C. To be published.

Other PDB entries of the same protein (UniProt Q8N300 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6J4P 1.6 Å, Structural basis of tubulin detyrosination by vasohibins-SVBP enzyme complex and…
6J7B 1.62 Å, Crystal structure of VASH1-SVBP in complex with epoY
6OCG 1.83 Å, Crystal structure of VASH1-SVBP complex bound with EpoY
6J8N 1.95 Å, Crystal structure of SVBP-VASH1 complex, mutation C169A of VASH1
6J4U 2.0 Å, Structural basis of tubulin detyrosination by vasohibins-SVBP enzyme complex and…
6OCH 2.0 Å, Crystal structure of VASH1-SVBP complex bound with parthenolide
6QBY 2.09 Å, Crystal structure of VASH 2 in complex with SVBP
6J4V 2.1 Å, Structural basis of tubulin detyrosination by vasohibins-SVBP enzyme complex and…
6NVQ 2.1 Å, Crystal structure of the VASH1-SVBP complex
6OCF 2.1 Å, The crystal structure of VASH1-SVBP complex
6JZC 2.2 Å, Structural basis of tubulin detyrosination
6K81 2.28 Å, Crystal structure of human VASH1-SVBP complex

Browse structure collections

About this viewer

MolViewer shows 6J8O directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.