6JCK: Complex structure of Axin-DIX and Dvl2-DIX

Complex structure of Axin-DIX and Dvl2-DIX. Determined by X-ray diffraction at 3.09 Å resolution. Released 15 Jan 2020.

Method: X-ray diffraction
Resolution: 3.09 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,179
Mol. weight: 18.69 kDa
Released: 15 Jan 2020

Explore 6JCK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6JCK contains 5 α-helices and 17 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	746-750	5	1
β-strand	753	1	2
α-helix	759-761	3
β-strand	762-765	4	1
β-strand	770	1	3
α-helix	771-775	5
β-strand	784-790	7	2
β-strand	800-803	4	2
β-strand	810	1	3
α-helix	811-812	2
β-strand	814	1	1
β-strand	817-819	3	1
β-strand	820-824	5	2

Chain B: 2 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	14-20	7	2
β-strand	27-31	5	2
β-strand	39	1	4
α-helix	40-47	8
α-helix	49-50	2
β-strand	54-57	4	2
β-strand	77	1	4
β-strand	80-81	2	2
β-strand	84-90	7	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Axin-1	A	protein	82	Homo sapiens	O15169 (AlphaFold model)
Segment polarity protein dishevelled homolog DVL-2	B	protein	82	Homo sapiens	O14641 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6JCK_1 Axin-1 (chains A)
DSIVVAYYFCGEPIPDRTLVRGRAVTLGQFKELLTKKGSYRYYFKKVSDEFDCGVVFEEV
REDEAVLPVFEEKIIGKVEKVD

Sequence of entity 2 (B), FASTA

>6JCK_2 Segment polarity protein dishevelled homolog DVL-2 (chains B)
GETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPAGAKYFFKSMDQDFGVAAEEI
SDDNARLPCFNGRVVSWLVSSD

Primary citation

A direct heterotypic interaction between the DIX domains of Dishevelled and Axin mediates signaling to beta-catenin. Yamanishi, K., Fiedler, M., Terawaki, S.I. et al. Sci Signal (2019) 12. DOI 10.1126/scisignal.aaw5505 · PubMed

Other PDB entries of the same protein (UniProt O15169 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1DK8 1.57 Å, Crystal structure of the rgs-homologous domain of axin
7SXJ 1.85 Å, BIO-2895 (BRD0705) bound GSK3beta-axin complex
1EMU 1.9 Å, Structure of the axin rgs-homologous domain in complex with a samp repeat from apc
7SXF 1.94 Å, BIO-2895 (BRD0705) bound GSK3alpha-axin complex
8RU3 2.0 Å, Crystal structure of beta-catenin in complex with alpha-helical peptide inhibitor
7SXH 2.09 Å, BIO-8546 bound GSK3beta-axin complex
4NM3 2.1 Å, Crystal structure of GSK-3/Axin complex bound to phosphorylated N-terminal…
5WZZ 2.1 Å, The SIAH E3 ubiquitin ligases promote Wnt/ beta-catenin signaling through mediating…
8RU4 2.13 Å, Crystal structure of Human Catenin Beta-1 in complex with stitched peptide inhibitor
4NM5 2.3 Å, Crystal structure of GSK-3/Axin complex bound to phosphorylated Wnt receptor LRP6 c-motif
4NM7 2.3 Å, Crystal structure of GSK-3/Axin complex bound to phosphorylated Wnt receptor LRP6 e-motif
8VME 2.3 Å, Crystal structure of the GSK-3/Axin complex bound to a phosphorylated beta-catenin T41A…

Browse structure collections

About this viewer

MolViewer shows 6JCK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.