6JJW: KIBRA and PTPN14 complex

Crystal Structure of KIBRA and PTPN14 complex. Determined by X-ray diffraction at 2.4 Å resolution. Released 25 Sept 2019.

Method: X-ray diffraction
Resolution: 2.4 Å
Organisms: Mus musculus, Homo sapiens
Chains: 2
Atoms: 960
Mol. weight: 20.19 kDa
Ligands: MG
Released: 25 Sept 2019

Explore 6JJW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6JJW contains 6 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	8-9	2
β-strand	12-16	5	1
β-strand	22-26	5	1
β-strand	31-33	3	1
α-helix	39-42	4
β-strand	59-64	6	2
β-strand	68-73	6	2
β-strand	78-80	3	2
α-helix	84-93	10

Chain U: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	436-439	4
α-helix	441-444	4
α-helix	445-451	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein KIBRA	A	protein	134	Mus musculus	Q5SXA9 (AlphaFold model)
Peptide from Tyrosine-protein phosphatase non-receptor type 14	U	protein	32	Homo sapiens	Q15678 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6JJW_1 Protein KIBRA (chains A)
GPGSEFELPLPEGWEEARDFDGKVYYIDHRNRTTSWIDPRDRYTKPLTFADCISDELPLG
WEEAYDPQVGDYFIDHNTKTTQIEDPRVQWRREQEHMLKDYLVVAQEALSAQKEIYQVKQ
QRLELAQQEYQQLH

Sequence of entity 2 (U), FASTA

>6JJW_2 Peptide from Tyrosine-protein phosphatase non-receptor type 14 (chains U)
GPGSSHRHSAIIVPSYRPTPDYETVMRQMKRG

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1

Water and common crystallization additives (GOL, FMT, CL) are not listed.

Primary citation

Decoding WW domain tandem-mediated target recognitions in tissue growth and cell polarity. Lin, Z., Yang, Z., Xie, R. et al. Elife (2019) 8. DOI 10.7554/eLife.49439 · PubMed

Other PDB entries of the same protein (UniProt Q5SXA9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6JJX 2.0 Å, Crystal Structure of KIBRA and Angiomotin complex
6JJY 2.3 Å, Crystal Structure of KIBRA and beta-Dystroglycan
6J68 2.5 Å, Structure of KIBRA and LATS1 Complex
6J69 2.75 Å, Structure of KIBRA and Dendrin Complex

Browse structure collections

About this viewer

MolViewer shows 6JJW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.