6JPV: PDB entry 6JPV

Structural analysis of AIMP2-DX2 and HSP70 interaction. Determined by X-ray diffraction at 2.15 Å resolution. Released 2 Oct 2019.

Method: X-ray diffraction
Resolution: 2.15 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,698
Mol. weight: 33.74 kDa
Released: 2 Oct 2019

Explore 6JPV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6JPV contains 10 α-helices and 22 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	395-396	2	1
β-strand	401-405	5	2
β-strand	409-414	6	2
β-strand	419-420	2	1
β-strand	422-428	7	3
β-strand	437-444	8	2
β-strand	449	1	2
α-helix	450-452	3
β-strand	454-462	9	2
α-helix	464-466	3
β-strand	474-480	7	3
β-strand	486-492	7	3
β-strand	498-503	6	3
α-helix	512-524	13
α-helix	526-536	11
α-helix	541-545	5

Chain B: 5 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	395-396	2	4
β-strand	401-405	5	5
β-strand	409-414	6	5
β-strand	419-420	2	4
β-strand	422-428	7	6
β-strand	437-444	8	5
β-strand	449	1	5
α-helix	450-452	3
β-strand	454-462	9	5
α-helix	464-466	3
β-strand	474-480	7	6
β-strand	486-492	7	6
β-strand	498-503	6	6
α-helix	512-524	13
α-helix	526-537	12
α-helix	539-544	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Heat shock 70 kDa protein 1A,Aminoacyl tRNA synthase complex-interacting multifunctional protein 2	A, B	protein	153	Homo sapiens	P0DMV8 (AlphaFold model), Q13155 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6JPV_1 Heat shock 70 kDa protein 1A,Aminoacyl tRNA synthase complex-interacting multifunctional protein 2 (chains A, B)
SDVAPLSLGLETAGGVMTALIKRNSTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDN
NLLGRFELSGIPPAPRGVPQIEVTFDIDANGILNVTATDKSTGKANKITITNDKGRLSKE
EIERMVQEAEKYKAEDEVQRERVSMYRLPNVHG

Primary citation

Targeting the interaction of AIMP2-DX2 with HSP70 suppresses cancer development. Lim, S., Cho, H.Y., Kim, D.G. et al. Nat Chem Biol (2020) 16:31-41. DOI 10.1038/s41589-019-0415-2 · PubMed

Other PDB entries of the same protein (UniProt P0DMV8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5BN8 1.34 Å, Crystal structure of nucleotide-free human Hsp70 NBD.
6K39 1.4 Å, Structural analysis of AIMP2-DX2 and HSP70 interaction
6G3R 1.4 Å, Structure of tellurium-centred Anderson-Evans polyoxotungstate (TEW) bound to the…
6ZYI 1.52 Å, Crystal structure of HSP70 ATPase domain in complex with ADP and calcium
5AQW 1.53 Å, Fragment-based screening of HSP70 sheds light on the functional role of ATP-binding site…
3Q49 1.54 Å, Crystal structure of the TPR domain of CHIP complexed with Hsp70-C peptide
5AQY 1.56 Å, Fragment-based screening of HSP70 sheds light on the functional role of ATP-binding site…
3ATV 1.58 Å, Crystal structure of human Hsp70 NBD in the ADP-bound and Mg ion-free state
3ATU 1.65 Å, Crystal structure of human Hsp70 NBD in the ADP- and Mg ion-bound state
5AQZ 1.65 Å, HSP72 with adenosine-derived inhibitor
6FHK 1.66 Å, Structure of a modified protein containing a genetically encoded phosphoserine
5BN9 1.69 Å, Crystal structure of ADP bound human Hsp70 NBD mutant R272K.

Browse structure collections

About this viewer

MolViewer shows 6JPV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.