Crystal structure of Lpg2147-Lpg2149 complex. Determined by X-ray diffraction at 1.97 Å resolution. Released 1 Apr 2020.
Explore 6K3B in 3D Show helices and sheets RCSB PDB PDBe
6K3B contains 31 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 10-24 | 15 | |
| α-helix | 25-29 | 5 | |
| α-helix | 33-44 | 12 | |
| α-helix | 45-47 | 3 | |
| α-helix | 54-63 | 10 | |
| α-helix | 70-71 | 2 | |
| α-helix | 74-86 | 13 | |
| α-helix | 88-96 | 9 | |
| α-helix | 98-99 | 2 | |
| β-strand | 100-101 | 2 | 1 |
| α-helix | 102-103 | 2 | |
| α-helix | 107-111 | 5 | |
| β-strand | 118-127 | 10 | 1 |
| β-strand | 132-135 | 4 | 2 |
| α-helix | 138-140 | 3 | |
| α-helix | 147 | 1 | |
| β-strand | 150-153 | 4 | 2 |
| β-strand | 158-161 | 4 | 2 |
| β-strand | 167-169 | 3 | 2 |
| α-helix | 174-183 | 10 | |
| α-helix | 187-189 | 3 | |
| β-strand | 191-193 | 3 | 2 |
| α-helix | 205-221 | 17 | |
| β-strand | 227-237 | 11 | 1 |
| α-helix | 245-246 | 2 | |
| β-strand | 249-251 | 3 | 1 |
| β-strand | 254 | 1 | 3 |
| β-strand | 258 | 1 | 3 |
| α-helix | 260-265 | 6 | |
| α-helix | 268-273 | 6 | |
| α-helix | 276-289 | 14 | |
| α-helix | 293-304 | 12 | |
| α-helix | 306 | 1 | |
| α-helix | 316-318 | 3 | |
| β-strand | 324-332 | 9 | 1 |
| α-helix | 335-352 | 18 | |
| α-helix | 358-380 | 23 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 11-36 | 26 | |
| α-helix | 44-53 | 10 | |
| α-helix | 61-63 | 3 | |
| α-helix | 70-77 | 8 | |
| α-helix | 79-82 | 4 | |
| α-helix | 92-110 | 19 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Lpg2147 | A | protein | 382 | Legionella pneumophila | Q5ZTL4 (AlphaFold model) |
| Uncharacterized protein | B | protein | 108 | Legionella pneumophila | Q5ZTL2 (AlphaFold model) |
>6K3B_1 Lpg2147 (chains A) GSHMEKTGLHVHEKIKHMVKNYGTMITGIPAEILGQNEAEISVGYVKKMGNMKENIAEVV RKSEMTQPTNSAGKASNEVCDLLLGTEGASEFEKSSYQVLSGDGSNLKGSLPNKNLLVRV EMDRFNAPQKYQKIKREEFNPETAEKNKIYLLEDQLVYLDIFGKVIDLGQTSDTCHRLFN AITTPFYQNYILYDEYIDPEESAEEAAMFEMGEIVKAKMKNIDCWTATHSFTIFVPESDS EDTRTLYPYQAYWTSHTLQQWFSGDKDEKLSRLGIDGYIEKLALLGTTTDSKIRSSIYGE LFSPPGKEHVFCTGMNEKFSPLRVKFKVTEVNPEIALQNLEEVQEFIDTNYPGENAKDQC ELYKIKAQEAMTKQLEMRLLIE
>6K3B_2 Uncharacterized protein (chains B) GSHMFFKDYQKKNVMRLLQDSLEKIINEWLKTDDESHTKLKSLQELSEMDINATSFAEHS PLPDFVTRLWLDPHKALDAMDKNISKNEIRKLIKETAREIELVFTHQK
Structural insights into the mechanism and inhibition of transglutaminase-induced ubiquitination by the Legionella effector MavC. Mu, Y., Wang, Y., Huang, Y. et al. Nat Commun (2020) 11:1774-1774. DOI 10.1038/s41467-020-15645-7 · PubMed
Other PDB entries of the same protein (UniProt Q5ZTL4 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6K3B directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.