6P5H: MavC middle insertion domain

Structure of MavC middle insertion domain. Determined by X-ray diffraction at 1.53 Å resolution. Released 27 May 2020.

Method: X-ray diffraction
Resolution: 1.53 Å
Organism: Legionella pneumophila
Chains: 2
Atoms: 1,981
Mol. weight: 24.5 kDa
Released: 27 May 2020

Explore 6P5H in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6P5H contains 10 α-helices and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 5 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	132-135	4	1
α-helix	138-140	3
α-helix	147	1
β-strand	150-154	5	1
β-strand	157-161	5	1
β-strand	167-169	3	1
α-helix	174-183	10
α-helix	187-189	3
β-strand	191-193	3	1
α-helix	205-220	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
MavC	A, B	protein	105	Legionella pneumophila	Q5ZTL4 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6P5H_1 MavC (chains A, B)
GPLGSRFNAPQKYQKIKREEFNPETAEKNKIYLLEDQLVYLDIFGKVIDLGQTSDTCHRL
FNAITTPFYQNYILYDEYIDPEESAEEAAMFEMGEIVKAKMKNID

Primary citation

Legionella effector MavC targets the Ube2N~Ub conjugate for noncanonical ubiquitination. Puvar, K., Iyer, S., Fu, J. et al. Nat Commun (2020) 11:2365-2365. DOI 10.1038/s41467-020-16211-x · PubMed

Other PDB entries of the same protein (UniProt Q5ZTL4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6ULH 1.97 Å, Structure of MavC in complex with its substrate in R3 spacegroup
6K3B 1.97 Å, Crystal structure of Lpg2147-Lpg2149 complex
5TSC 2.01 Å, The crystal structure of Lpg2147 from Legionella pneumophila
6P5B 2.1 Å, Crystal Structure of MavC in Complex with Ub-UbE2N
6UMS 2.34 Å, Crystal structure of MavC in complex with its substrate mimic in C222(1) space group
6KG6 2.39 Å, Crystal structure of MavC/UBE2N-Ub complex
7BXH 2.7 Å, MavC-Lpg2149 complex
7BXG 2.71 Å, MavC-UBE2N-Ub complex
6UMP 2.8 Å, Crystal structure of MavC in complex with substrate mimic in P65 space group
6KL4 2.85 Å, Crystal structure of MavC-UBE2N-Ub
6KFP 2.92 Å, Crystal structure of MavC ternary complex

Browse structure collections

About this viewer

MolViewer shows 6P5H directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.