6K9H: Human LXR-beta

Human LXR-beta in complex with an agonist. Determined by X-ray diffraction at 2.5 Å resolution. Released 22 Apr 2020.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,405
Mol. weight: 63.07 kDa
Ligands: D40
Released: 22 Apr 2020

Explore 6K9H in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6K9H contains 20 α-helices and 5 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	222-236	15
α-helix	265-288	24
α-helix	297-318	22
β-strand	320-321	2	1
β-strand	326-328	3	1
β-strand	334-335	2	1
α-helix	337-342	6
α-helix	347-363	17
α-helix	367-378	12
α-helix	389-410	22
α-helix	417-444	28
α-helix	451-457	7
α-helix	469-474	6

Chain B: 10 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	222-236	15
α-helix	264-288	25
α-helix	297-318	22
β-strand	321	1	2
β-strand	326	1	2
α-helix	337-342	6
α-helix	347-363	17
α-helix	367-378	12
α-helix	389-410	22
α-helix	417-444	28
α-helix	451-457	7
α-helix	469-475	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Oxysterols receptor LXR-beta	A, B	protein	274	Homo sapiens	P55055 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6K9H_1 Oxysterols receptor LXR-beta (chains A, B)
MGHHHHHHGEGVQLTAAQELMIQQLVAAQLQCNKRSFSDQPKVTPWPLGADPASGSASQQ
RFAHFTELAIISVQEIVDFAKQVPGFLQLGREDQIALLKASTIEIMLLETARRYNHETEC
ITFLKDFTYSKDDFHRAGLQVEFINPIFEFSRAMRRLGLDDAEYALLIAINIFSADRPNV
QEPGRVEALQQPYVEALLSYTRIKRPQDQLRFPRMLMKLVSLRTLSSVHSEQVFALRLQD
KKLPPLLSEIWDVHEGSGSGSHKILHRLLQDSSS

Ligands and cofactors

ID	Name	Formula	Copies
D40	~{tert}-butyl (2'~{S},3~{S})-2-oxidanylidene-2'-phenyl-spiro[1~{H}-indole-3,3'-…	C22 H24 N2 O3	2

Primary citation

Discovery of new LXR beta agonists as glioblastoma inhibitors. Chen, H., Chen, Z., Zhang, Z. et al. Eur J Med Chem (2020) 194:112240-112240. DOI 10.1016/j.ejmech.2020.112240 · PubMed

Other PDB entries of the same protein (UniProt P55055 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6S5K 1.6 Å, LXRbeta ligand binding domain in complex with small molecule inhibitors
6S4N 1.9 Å, LXRbeta ligand binding domain in comlpex with small molecule inhibitors
6S4T 2.0 Å, LXRbeta ligand binding domain in comlpex with small molecule inhibitors
4RAK 2.04 Å, Crystal structure of nuclear receptor subfamily 1, group h, member 2 (lxrb) complexed…
1PQ9 2.1 Å, Human lxr beta hormone receptor complexed with T0901317 complex
1UPV 2.1 Å, Crystal structure of the human Liver X receptor beta ligand binding domain in complex…
3L0E 2.3 Å, X-ray crystal structure of a Potent Liver X Receptor Modulator
1PQ6 2.4 Å, Human lxr beta hormone receptor / GW3965 complex
1UPW 2.4 Å, Crystal structure of the human Liver X receptor beta ligand binding domain in complex…
3KFC 2.4 Å, Complex Structure of LXR with an agonist
5JY3 2.4 Å, Crystal structure of lxrbeta (nuclear receptor subfamily 1, group H, member 2) complexed…
4DK7 2.45 Å, Crystal structure of LXR ligand binding domain in complex with full agonist 1

Browse structure collections

About this viewer

MolViewer shows 6K9H directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.