6KO2: BRD4-Brmo2

Crystal Structure of BRD4-Brmo2 in complex with H2A.ZK4acK7ac peptide. Determined by X-ray diffraction at 1.5 Å resolution. Released 12 Aug 2020.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,109
Mol. weight: 13.61 kDa
Released: 12 Aug 2020

Explore 6KO2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6KO2 contains 8 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	352-364	13
α-helix	367-369	3
α-helix	370-373	4
α-helix	374-376	3
α-helix	390-393	4
α-helix	400-408	9
α-helix	415-432	18
α-helix	438-455	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Bromodomain-containing protein 4	A	protein	111	Homo sapiens	O60885 (AlphaFold model)
histone H2A.Z peptide	B	protein	7	Homo sapiens	P0C0S5 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6KO2_1 Bromodomain-containing protein 4 (chains A)
GPLGSEQLKCCSGILKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSK
LEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKM

Sequence of entity 2 (B), FASTA

>6KO2_2 histone H2A.Z peptide (chains B)
GKAGKDS

Primary citation

Crystal Structure of BRD4-Bromo2 in complex with H2A.ZK4acK7ac peptide. Zheng, S.P., Li, H.T. To be published.

Other PDB entries of the same protein (UniProt O60885 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4QB3 0.94 Å, Crystal structure of the first bromodomain of human BRD4 in complex with Olinone
6FO5 0.95 Å, First domain of human bromodomain BRD4 in complex with inhibitor #17
7Z9W 0.99 Å, BRD4 in complex with FragLite1
4ZC9 0.99 Å, Crystal Structure of the BRD4a/DB-2-190 complex
9P34 0.99 Å, Crystal structure of the Bromo domain 1 in human Bromodomain Containing Protein 4 with a…
6I7Y 1.0 Å, Crystal Structure of the first bromodomain of BRD4 in complex with RT56
7ZAJ 1.0 Å, BRD4 in complex with FragLite16
8YMG 1.01 Å, BRD4-BD1 in complex with 7-[4-chloro-1-(tetrahydropyran-4-ylmethyl)imidazol-2-yl]-5-methy…
8YMI 1.01 Å, BRD4-BD1 in complex with 2-{[(3S)-1-benzylpyrrolidin-3-yl]methyl}-5-methyl-7-(1-methylpyr…
9P33 1.01 Å, Crystal structure of the Bromo domain 1 in human Bromodomain Containing Protein 4 with a…
8YMF 1.01 Å, BRD4-BD1 in complex with 7-[2-(cyclopropylmethoxy)phenyl]-5-methyl-2-[(1-methylsulfonyl-4…
7Z9Y 1.04 Å, BRD4 in complex with FragLite2

Browse structure collections

About this viewer

MolViewer shows 6KO2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.