6KTS: C34N126K/N36

Structure of C34N126K/N36. Determined by X-ray diffraction at 1.65 Å resolution. Released 16 Sept 2020.

Method: X-ray diffraction
Resolution: 1.65 Å
Organism: Human immunodeficiency virus 1
Chains: 6
Atoms: 1,987
Mol. weight: 25.34 kDa
Released: 16 Sept 2020

Explore 6KTS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6KTS contains 6 α-helices and 0 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	629-659	31

Chains B, E and N: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	547-580	34

Chains C and D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	629-660	32

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Envelope glycoprotein	B, E, N	protein	37	Human immunodeficiency virus 1	P04578 (AlphaFold model)
Glycoprotein 41	A, C, D	protein	35	Human immunodeficiency virus 1	P04578 (AlphaFold model)

Sequence of entity 1 (B, E, N), FASTA

>6KTS_1 Envelope glycoprotein (chains B, E, N)
XSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARIL

Sequence of entity 2 (A, C, D), FASTA

>6KTS_2 Glycoprotein 41 (chains A, C, D)
XWMEWDREINKYTSLIHSLIEESQNQQEKNEQELL

Primary citation

Structural and Functional Characterization of the Secondary Mutation N126K Selected by Various HIV-1 Fusion Inhibitors. Yu, D., Su, Y., Ding, X. et al. Viruses (2020) 12. DOI 10.3390/v12030326 · PubMed

Other PDB entries of the same protein (UniProt P04578 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8F3A 1.2 Å, HIV-1 gp41 coiled-coil pocket IQN17
6UCF 1.29 Å, N123-VRC34_pI4 HIV neutralizing antibody in complex with HIV fusion peptide residue…
6PSA 1.3 Å, PIE12 D-peptide against HIV entry (in complex with IQN17 Q577R resistance mutant)
6UCE 1.38 Å, N123-VRC34_pI3 HIV neutralizing antibody in complex with HIV fusion peptide residue…
9ARN 1.41 Å, Structure and interactions of HIV-1 gp41 CHR-NHR reverse hairpin constructs reveal…
1DF4 1.45 Å, Interactions between HIV-1 GP41 core and detergents and their implications for membrane…
6BXP 1.45 Å, Crystal Structure of HLA-B*57:01 with a modified HIV peptide RKV-Kyn
7EKB 1.45 Å, Crystal structure of 4E10 modified with pyrene acetamide
5X08 1.49 Å, Crystal structure of broadly neutralizing anti-HIV-1 antibody 4E10, mutant Npro, with…
6JQK 1.5 Å, Structure of C34M/N36
5TKK 1.55 Å, Structure of mouse vaccination-elicited HIV neutralizing antibody vFP5.01 in complex…
6PDR 1.55 Å, Vaccine-elicited murine FP-targeting antibody vFP25.18 in complex with HIV fusion…

Browse structure collections

About this viewer

MolViewer shows 6KTS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.