6KWZ: Fragmin F3 domain with calcium ion

Crystal structure of fragmin F3 domain with calcium ion. Determined by X-ray diffraction at 1.55 Å resolution. Released 1 Jan 2020.

Method: X-ray diffraction
Resolution: 1.55 Å
Organism: Physarum polycephalum
Chains: 2
Atoms: 1,837
Mol. weight: 21.64 kDa
Ligands: CA
Released: 1 Jan 2020

Explore 6KWZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6KWZ contains 8 α-helices and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	278-283	6	1
β-strand	290-296	7	1
α-helix	297-299	3
α-helix	302-304	3
β-strand	310-314	5	1
β-strand	319-323	5	1
α-helix	329-346	18
β-strand	354-358	5	1
α-helix	364-370	7

Chain B: 4 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	278-283	6	2
β-strand	290-296	7	2
α-helix	297-299	3
α-helix	302-304	3
β-strand	310-314	5	2
β-strand	319-323	5	2
α-helix	329-346	18
β-strand	354-358	5	2
α-helix	364-369	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Actin-binding protein fragmin P	A, B	protein	98	Physarum polycephalum	Q94707 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6KWZ_1 Actin-binding protein fragmin P (chains A, B)
GPPAVLLRLSDASGKFEFTEVARGLKVKRNLLDSNDVFVLYTGAEVFAWVGKHASVGEKK
KALSFAQEYVQKAGLPIHTPVARILEGGENEVFEDFFD

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	2

Primary citation

Novel inter-domain Ca2+-binding site in the gelsolin superfamily protein fragmin. Takeda, S., Fujiwara, I., Sugimoto, Y. et al. J Muscle Res Cell Motil (2020) 41:153-162. DOI 10.1007/s10974-019-09571-5 · PubMed

Other PDB entries of the same protein (UniProt Q94707 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7W4Z 1.15 Å, Crystal structure of fragmin domain-1 in complex with actin (AMPPNP-form)
7W50 1.15 Å, Crystal structure of fragmin domain-1 in complex with actin (ADP-Pi-form)
7W51 1.2 Å, Crystal structure of fragmin domain-1 in complex with actin (ADP-form)
8GT1 1.35 Å, Crystal structure of human cardiac alpha actin A108G mutant (ADP-Pi state) in complex…
8GSW 1.4 Å, Crystal structure of human cardiac alpha actin A108G mutant (AMPPNP state) in complex…
8GT5 1.4 Å, Crystal structure of human cardiac alpha actin Q137A mutant (ADP-Pi state) in complex…
8GSU 1.5 Å, Crystal structure of human cardiac alpha actin (WT_ADP-Pi) in complex with fragmin F1…
8GT2 1.5 Å, Crystal structure of human cardiac alpha actin P109A mutant (AMPPNP state) in complex…
8GT3 1.5 Å, Crystal structure of human cardiac alpha actin P109A mutant (ADP-Pi state) in complex…
8GT4 1.55 Å, Crystal structure of human cardiac alpha actin Q137A mutant (AMPPNP state) in complex…
9L2N 1.7 Å, Crystal structure of Cytochalasin D bound to a filamentous conformation actin
6LJC 1.85 Å, Crystal structure of fragmin F2-F3 domains (calcium and magnesium condition)

Browse structure collections

About this viewer

MolViewer shows 6KWZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.