6LQZ: Taf14ET-Sth1EBMC

Name: PDB 6LQZ: Solution structure of Taf14ET-Sth1EBMC
Published: 2020-08-05
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transcription

Solution structure of Taf14ET-Sth1EBMC. Determined by solution NMR. Released 5 Aug 2020.

Method: Solution NMR
Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Chains: 2
Atoms: 1,004
Mol. weight: 14.7 kDa
Released: 5 Aug 2020

Explore 6LQZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6LQZ contains 4 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	179-186	8
α-helix	191-203	13
β-strand	210	1	1
β-strand	213-214	2	1
β-strand	219-223	5	1
α-helix	224-226	3
α-helix	229-243	15

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	1205-1209	5	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription initiation factor TFIID subunit 14	A	protein	72	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	P35189 (AlphaFold model)
Nuclear protein STH1/NPS1	B	protein	60	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	P32597 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6LQZ_1 Transcription initiation factor TFIID subunit 14 (chains A)
SKGSVDLEKLAFGLTKLNEDDLVGVVQMVTDNKTPEMNVTNNVEEGEFIIDLYSLPEGLL
KSLWDYVKKNTE

Sequence of entity 2 (B), FASTA

>6LQZ_2 Nuclear protein STH1/NPS1 (chains B)
SEVKSSSVEIINGSESKKKKPKLTVKIKLNKTTVLENNDGKRAEEKPESKSPAKKTAAKY

Primary citation

Taf14 recognizes a common motif in transcriptional machineries and facilitates their clustering by phase separation. Chen, G., Wang, D., Wu, B. et al. Nat Commun (2020) 11:4206-4206. DOI 10.1038/s41467-020-18021-7 · PubMed

Other PDB entries of the same protein (UniProt P35189 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7UHE 1.66 Å, Taf14 ET domain in complex with C-terminal tail of Taf2
3QRL 1.7 Å, Crystal Structure of the Taf14 YEATS domain
6MIQ 1.75 Å, Crystal structure of Taf14 YEATS domain in complex with histone H3K9bu
6MIO 1.85 Å, Crystal structure of Taf14 YEATS domain in complex with histone H3K9pr
5D7E 1.9 Å, Crystal structure of Taf14 YEATS domain in complex with H3K9ac
6MIN 1.9 Å, Crystal structure of Taf14 YEATS domain G82A mutant in complex with histone H3K9cr
8U77 1.93 Å, Crystal structure of Taf14 in complex with Yng1
6MIP 2.0 Å, Crystal structure of Taf14 YEATS domain G82A mutant
7F4A 2.0 Å, Crystal structure of Taf14 YEATS domain in complex with H3K9bz peptide
5IOK 2.22 Å, Crystal structure of Taf14 YEATS domain in complex with histone H3K9cr
9VKW 3.13 Å, Cryo-EM structure of the NuA3 complex bound to Ace-coenzyme A
9UUS 3.2 Å, The NuA3 histone acetyltransferase complex bound to acetyl-CoA and H3 tail

Browse structure collections

About this viewer

MolViewer shows 6LQZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.