6M33: Homo Sapian GCP6 N-terminus and Mozart1

Crystal structure of Homo Sapian GCP6 N-terminus and Mozart1. Determined by X-ray diffraction at 3.29 Å resolution. Released 3 Feb 2021.

Method: X-ray diffraction
Resolution: 3.29 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,218
Mol. weight: 22.35 kDa
Released: 3 Feb 2021

Explore 6M33 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6M33 contains 9 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	1-3	3
α-helix	4-14	11
α-helix	29-48	20
α-helix	67-79	13
α-helix	83-97	15
α-helix	108-116	9

Chain B: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	12-34	23
α-helix	41-53	13
α-helix	57-75	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Gamma-tubulin complex component 6	A	protein	124	Homo sapiens	Q96RT7 (AlphaFold model)
Mitotic-spindle organizing protein 1	B	protein	85	Homo sapiens	Q08AG7 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6M33_1 Gamma-tubulin complex component 6 (chains A)
GPLGSMASITQLFDDLCEALLPAAKTHLGQRSVNRKRAKRSLKKVAYNALFTNLFQDETQ
QLQPDMSKLPARNKILMLSFDLRVGGLGPKADRLEELVEELEAAPCCPLLEVGSVLDLLV
QLAG

Sequence of entity 2 (B), FASTA

>6M33_2 Mitotic-spindle organizing protein 1 (chains B)
GPHMASSSGAGAAAAAAAANLNAVRETMDVLLEISRILNTGLDMETLSICVRLCEQGINP
EALSSVIKELRKATEALKAAENMTS

Primary citation

MZT Proteins Form Multi-Faceted Structural Modules in the gamma-Tubulin Ring Complex. Wieczorek, M., Huang, T.L., Urnavicius, L. et al. Cell Rep (2020) 31:107791-107791. DOI 10.1016/j.celrep.2020.107791 · PubMed

Other PDB entries of the same protein (UniProt Q96RT7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8RX1 3.57 Å, CryoEM structure of the gTuRC-CM1dim complex
6X0U 3.6 Å, Structure of MZT1/GCP3-NHD and MZT1/GCP6-NHD in the gamma-TuRC lumenal bridge
9SMX 3.67 Å, CM1-activated gTuRC in complex with nascent alpha-E254D mutant microtubules
8Q62 3.72 Å, Early closed conformation of the g-tubulin ring complex
7AS4 4.13 Å, Recombinant human gTuRC
6V6S 4.3 Å, Structure of the native human gamma-tubulin ring complex
6V6C 4.5 Å, Structure of GCP6 in the native human gamma-tubulin ring complex
9H9P 4.5 Å, Spokes 12 and 13 of the human gamma-tubulin ring complex in complex with CDK5RAP2 and…
9QVN 4.7 Å, Cryo-EM reconstruction of the NEDD1 anchor protein bound to the gamma-tubulin ring complex
7QJ0 5.32 Å, Structure of recombinant human gamma-Tubulin Ring Complex 6-spoked assembly intermediate…
9QVM 6.8 Å, Cryo-EM reconstruction of the NEDD1 anchor protein and CDK5RAP2 bound to the…
7QJ1 7.0 Å, Structure of the recombinant human gamma-Tubulin Ring Complex 6-spoked assembly…

Browse structure collections

About this viewer

MolViewer shows 6M33 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.