6MOH: Dimeric DARPin C_R3 complex with EpoR

Dimeric DARPin C_R3 complex with EpoR. Determined by X-ray diffraction at 3.2 Å resolution. Released 5 Jun 2019.

Method: X-ray diffraction
Resolution: 3.2 Å
Organisms: synthetic construct, Homo sapiens
Chains: 4
Atoms: 5,510
Mol. weight: 86.08 kDa
Ligands: PO4
Released: 5 Jun 2019

Explore 6MOH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6MOH contains 39 α-helices and 38 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	10-20	11
α-helix	24-32	9
α-helix	47-54	8
α-helix	57-65	9
α-helix	80-87	8
α-helix	90-99	10
α-helix	113-119	7
α-helix	123-132	10
α-helix	146-153	8
α-helix	156-161	6

Chain B: 10 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	10-21	12
α-helix	24-32	9
α-helix	47-54	8
α-helix	57-65	9
α-helix	80-87	8
α-helix	90-99	10
α-helix	113-120	8
α-helix	123-132	10
β-strand	139	1	1
β-strand	145	1	1
α-helix	146-153	8
α-helix	156-161	6

Chain C: 10 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	8-21	14
β-strand	27-29	3	2
β-strand	30	1	3
β-strand	36-42	7	2
α-helix	50-52	3
β-strand	53-59	7	4
α-helix	63-64	2
β-strand	65-67	3	4
β-strand	70-73	4	2
β-strand	79-85	7	2
α-helix	87-89	3
β-strand	95-102	8	4
β-strand	107-114	8	4
α-helix	115-117	3
β-strand	119-120	2	3
α-helix	121-124	4
β-strand	125-131	7	5
β-strand	138-143	6	5
α-helix	144-145	2
α-helix	151-153	3
β-strand	154-161	8	6
β-strand	170-174	5	6
β-strand	180-183	4	5
α-helix	191-192	2
β-strand	193-200	8	6
β-strand	207-208	2	3
α-helix	211-215	5
β-strand	216	1	6

Chain D: 9 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	8-21	14
β-strand	27-29	3	7
β-strand	30	1	8
β-strand	36-42	7	7
α-helix	50-52	3
β-strand	53-59	7	9
α-helix	63-64	2
β-strand	65-67	3	9
β-strand	70-73	4	7
β-strand	79-85	7	7
α-helix	87-89	3
β-strand	95-102	8	9
β-strand	107-114	8	9
α-helix	115-117	3
β-strand	119-120	2	8
α-helix	121-124	4
β-strand	125-131	7	10
β-strand	138-143	6	10
α-helix	144-145	2
α-helix	151-153	3
β-strand	154-161	8	11
β-strand	169-174	6	11
β-strand	180-183	4	10
β-strand	191-200	10	11
β-strand	207-208	2	8
α-helix	211-215	5
β-strand	216-219	4	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Dimeric DARPin E2C (C_R3)	A, B	protein	165	synthetic construct
Erythropoietin receptor	C, D	protein	229	Homo sapiens	P19235 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6MOH_1 Dimeric DARPin E2C (C_R3) (chains A, B)
MGHHHHHHSDLGKKLLKAARAGQKDEVRILMANGADVNATDIWDATPLHLAALIGHAEIV
AVLLENGADVNASDITGTTPLHLAATMGHDEIVLILLLKGADVNAYDLNGATPLHLAARM
GHKRIVLVLILAGADVNAQDKFGKTAFDISIDNGNEDLAKILQKQ

Sequence of entity 2 (C, D), FASTA

>6MOH_2 Erythropoietin receptor (chains C, D)
FAGSADPKFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGPGQYSFSYQLEDE
PWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRVTAASGAPRYHRVIHINEVVLLD
APVGLVARLADESGHVVLRWLPPPETPMTSHIRYEVDVSAGQGAGSVQRVEILEGRTECV
LSNLRGRTRYTFAVRARMAEPSFGGFWSAWSEPVSLLTPSDLDKEKAAA

Ligands and cofactors

ID	Name	Formula	Copies
PO4	Phosphate ion	O4 P	7

Water and common crystallization additives (NA) are not listed.

Primary citation

Topological control of cytokine receptor signaling induces differential effects in hematopoiesis. Mohan, K., Ueda, G., Kim, A.R. et al. Science (2019) 364. DOI 10.1126/science.aav7532 · PubMed

Other PDB entries of the same protein (UniProt P19235 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1EER 1.9 Å, Crystal structure of human erythropoietin complexed to its receptor at 1.9 Å
6MOI 2.06 Å, Dimeric DARPin C_angle_R5 complex with EpoR
6MOE 2.09 Å, Monomeric DARPin E2 complex with EpoR
8VUI 2.1 Å, Structure of FabS1CE-EPR-1, an elbow-locked Fab, in complex with the erythropoeitin…
1ERN 2.4 Å, Native structure of the extracellular domain of erythropoietin (EPO) receptor [ebp]
6MOJ 2.43 Å, Dimeric DARPin A_angle_R5 complex with EpoR
4Y5V 2.6 Å, Diabody 305 complex with EpoR
6E2Q 2.65 Å, Structure of human JAK2 FERM/SH2 in complex with Erythropoietin Receptor
1EBA 2.7 Å, Complex between the extracellular domain of erythropoietin (EPO) receptor [ebp] and an…
1CN4 2.8 Å, Erythropoietin complexed with extracellular domains of erythropoietin receptor
1EBP 2.8 Å, Complex between the extracellular domain of erythropoietin (EPO) receptor [ebp] and an…
4Y5Y 2.85 Å, Diabody 330 complex with EpoR

Browse structure collections

About this viewer

MolViewer shows 6MOH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.