6MOL: Monoextended DARPin M_R12 complex with EpoR

Monoextended DARPin M_R12 complex with EpoR. Determined by X-ray diffraction at 3.16 Å resolution. Released 5 Jun 2019.

Method: X-ray diffraction
Resolution: 3.16 Å
Organisms: synthetic construct, Homo sapiens
Chains: 3
Atoms: 6,519
Mol. weight: 98.57 kDa
Released: 5 Jun 2019

Explore 6MOL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6MOL contains 44 α-helices and 36 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 28 helices, 0 β-strands

Element	Residues	Length
α-helix	4-14	11
α-helix	17-26	10
α-helix	40-47	8
α-helix	50-58	9
α-helix	73-80	8
α-helix	83-91	9
α-helix	106-113	8
α-helix	116-125	10
α-helix	139-146	8
α-helix	149-158	10
α-helix	172-179	8
α-helix	182-191	10
α-helix	205-212	8
α-helix	215-223	9
α-helix	238-245	8
α-helix	248-257	10
α-helix	271-278	8
α-helix	281-290	10
α-helix	300-307	8
α-helix	310-318	9
α-helix	333-340	8
α-helix	343-351	9
α-helix	366-373	8
α-helix	376-384	9
α-helix	399-406	8
α-helix	409-417	9
α-helix	432-439	8
α-helix	442-453	12

Chain B: 8 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	9-21	13
β-strand	27-29	3	1
β-strand	30	1	2
β-strand	37-43	7	1
β-strand	53-58	6	3
β-strand	65-67	3	3
β-strand	70-74	5	1
β-strand	78-84	7	1
β-strand	95-102	8	3
β-strand	107-114	8	3
α-helix	115-117	3
β-strand	119	1	2
α-helix	121-124	4
β-strand	125-131	7	4
β-strand	138-143	6	4
α-helix	144-145	2
α-helix	151-153	3
β-strand	154-162	9	5
β-strand	170-174	5	5
α-helix	175	1
β-strand	180-183	4	4
β-strand	191-200	10	5
α-helix	201	1
β-strand	207	1	2
α-helix	209-215	7
β-strand	216-219	4	5

Chain C: 8 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	11-21	11
β-strand	27-29	3	6
β-strand	30	1	7
β-strand	37-42	6	6
β-strand	53-58	6	8
β-strand	65-67	3	8
β-strand	70-74	5	6
β-strand	78-84	7	6
β-strand	95-102	8	8
β-strand	107-114	8	8
α-helix	115-117	3
β-strand	119	1	7
α-helix	121-124	4
β-strand	125-131	7	9
β-strand	138-143	6	9
α-helix	144-145	2
α-helix	151-153	3
β-strand	154-162	9	10
β-strand	170-174	5	10
α-helix	175	1
β-strand	180-182	3	9
β-strand	191-200	10	10
α-helix	201	1
β-strand	207	1	7
α-helix	209-215	7
β-strand	216-219	4	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Monoextended DARPin R12 (M_R12)	A	protein	461	synthetic construct
Erythropoietin receptor	B, C	protein	229	Homo sapiens	P19235 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6MOL_1 Monoextended DARPin R12 (M_R12) (chains A)
MGSDLGKKLLKAARAGQDDEVRILMANGADVNATDIWDATPLHLAALIGHLEIVEVLLKN
GADVNASDITGTTPLHLAATMGHLEIVEVLLKYGADVNAYDLNGATPLHLAARMGHVEIV
EVLLKYGADVNAQDAAGGTPLHEAARAGHLEIVEVLLKYGADVNAVDAAGGTPLHEAARA
GHLEIVEVLLKYGADVNAVDAAGGTPLHEAARAGHLEIVEVLLKYGADVNAVDAAGGTPL
HEAARAGHLEIVEVLLKYGADVNAVDAAGGTPLHEAARAGHLEIVEVLLKYGADVNAVGT
PLHKAARAGHLEIVEVLLKYGADVNATDIWDATPLHLAALIGHLEIVEVLLKNGADVNAS
DITGTTPLHLAATMGHLEIVEVLLKYGADVNAYDLNGATPLHLAARMGHVEIVEVLLKYG
ADVNAQDKFGKTAFDISIDNGNEDLAEILQAAALEHHHHHH

Sequence of entity 2 (B, C), FASTA

>6MOL_2 Erythropoietin receptor (chains B, C)
FAGSADPKFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGPGQYSFSYQLEDE
PWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRVTAASGAPRYHRVIHINEVVLLD
APVGLVARLADESGHVVLRWLPPPETPMTSHIRYEVDVSAGQGAGSVQRVEILEGRTECV
LSNLRGRTRYTFAVRARMAEPSFGGFWSAWSEPVSLLTPSDLDKEKAAA

Primary citation

Topological control of cytokine receptor signaling induces differential effects in hematopoiesis. Mohan, K., Ueda, G., Kim, A.R. et al. Science (2019) 364. DOI 10.1126/science.aav7532 · PubMed

Other PDB entries of the same protein (UniProt P19235 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1EER 1.9 Å, Crystal structure of human erythropoietin complexed to its receptor at 1.9 Å
6MOI 2.06 Å, Dimeric DARPin C_angle_R5 complex with EpoR
6MOE 2.09 Å, Monomeric DARPin E2 complex with EpoR
8VUI 2.1 Å, Structure of FabS1CE-EPR-1, an elbow-locked Fab, in complex with the erythropoeitin…
1ERN 2.4 Å, Native structure of the extracellular domain of erythropoietin (EPO) receptor [ebp]
6MOJ 2.43 Å, Dimeric DARPin A_angle_R5 complex with EpoR
4Y5V 2.6 Å, Diabody 305 complex with EpoR
6E2Q 2.65 Å, Structure of human JAK2 FERM/SH2 in complex with Erythropoietin Receptor
1EBA 2.7 Å, Complex between the extracellular domain of erythropoietin (EPO) receptor [ebp] and an…
1CN4 2.8 Å, Erythropoietin complexed with extracellular domains of erythropoietin receptor
1EBP 2.8 Å, Complex between the extracellular domain of erythropoietin (EPO) receptor [ebp] and an…
4Y5Y 2.85 Å, Diabody 330 complex with EpoR

Browse structure collections

About this viewer

MolViewer shows 6MOL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.