6MUO: Histone H3-like centromeric protein A
CENP-A nucleosome bound by two copies of CENP-C(CD) and one copy CENP-N(NT). Determined by electron microscopy at 3.6 Å resolution. Released 24 Jul 2019.
- Method
- Electron microscopy
- Resolution
- 3.6 Å
- Organism
- Homo sapiens
- Chains
- 13
- Atoms
- 14,015
- Mol. weight
- 209.48 kDa
- Released
- 24 Jul 2019
Explore 6MUO in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
6MUO contains 47 α-helices and 23 β-strands across 9 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 4 helices, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| α-helix | 48-54 | 7 | |
| α-helix | 64-77 | 14 | |
| β-strand | 85-86 | 2 | 1 |
| α-helix | 88-113 | 26 | |
| α-helix | 124-131 | 8 | |
Chain B: 4 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 31-41 | 11 | |
| α-helix | 50-62 | 13 | |
| α-helix | 66-75 | 10 | |
| β-strand | 80-81 | 2 | 1 |
| α-helix | 83-93 | 11 | |
| β-strand | 96-97 | 2 | 2 |
Chain C: 6 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 18-21 | 4 | |
| α-helix | 27-36 | 10 | |
| β-strand | 43 | 1 | 3 |
| α-helix | 47-59 | 13 | |
| α-helix | 62-72 | 11 | |
| β-strand | 77-78 | 2 | 4 |
| α-helix | 81-87 | 7 | |
| α-helix | 91-96 | 6 | |
| β-strand | 100-101 | 2 | 5 |
Chain D: 5 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 38-48 | 11 | |
| β-strand | 53-54 | 2 | 4 |
| α-helix | 58-64 | 7 | |
| α-helix | 66-83 | 18 | |
| β-strand | 89 | 1 | 3 |
| α-helix | 95-98 | 4 | |
| α-helix | 104-122 | 19 | |
Chain E: 6 helices, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| α-helix | 47-54 | 8 | |
| α-helix | 64-77 | 14 | |
| β-strand | 85-86 | 2 | 6 |
| α-helix | 91-94 | 4 | |
| α-helix | 98-110 | 13 | |
| α-helix | 114-116 | 3 | |
| α-helix | 123-126 | 4 | |
Chain F: 4 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 31-41 | 11 | |
| α-helix | 50-62 | 13 | |
| α-helix | 66-75 | 10 | |
| β-strand | 80-81 | 2 | 6 |
| α-helix | 84-93 | 10 | |
| β-strand | 96-97 | 2 | 5 |
Chain G: 5 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 17-21 | 5 | |
| α-helix | 28-36 | 9 | |
| β-strand | 42-43 | 2 | 7 |
| α-helix | 47-71 | 25 | |
| β-strand | 77-78 | 2 | 8 |
| α-helix | 80-87 | 8 | |
| α-helix | 92-96 | 5 | |
| β-strand | 100-101 | 2 | 2 |
Chain H: 5 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 38-48 | 11 | |
| β-strand | 53-54 | 2 | 8 |
| α-helix | 56-83 | 28 | |
| β-strand | 88-89 | 2 | 7 |
| α-helix | 95-98 | 4 | |
| α-helix | 104-114 | 11 | |
| α-helix | 116-122 | 7 | |
1 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Histone H3-like centromeric protein A | A, E | protein | 102 | Homo sapiens | P49450 (AlphaFold model) |
| Histone H4 | B, F | protein | 94 | Homo sapiens | P62805 (AlphaFold model) |
| Histone H2A type 1-C | C, G | protein | 105 | Homo sapiens | Q93077 (AlphaFold model) |
| Histone H2B type 2-F | D, H | protein | 92 | Homo sapiens | Q5QNW6 (AlphaFold model) |
| Dna/rna (147-mer) | I | DNA | 147 | Homo sapiens | |
| Dna/rna (147-mer) | J | DNA | 147 | Homo sapiens | |
| Centromere protein C | K, L | protein | 20 | Homo sapiens | Q03188 |
| Centromere protein N | M | protein | 212 | Homo sapiens | Q96H22 |
Sequence of entity 1 (A, E), FASTA
>6MUO_1 Histone H3-like centromeric protein A (chains A, E)
HQHSRRRQGWLKEIRKLQKSTHLLIRKLPFSRLAREICVKFTRGVDFNWQAQALLALQEA
AEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGLEEGL
Sequence of entity 2 (B, F), FASTA
>6MUO_2 Histone H4 (chains B, F)
KGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIR
DAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFG
Sequence of entity 3 (C, G), FASTA
>6MUO_3 Histone H2A type 1-C (chains C, G)
KAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARD
NKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQSVLLP
Sequence of entity 4 (D, H), FASTA
>6MUO_4 Histone H2B type 2-F (chains D, H)
RKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSR
EIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS
Sequence of entity 5 (I), FASTA
>6MUO_5 DNA/RNA (147-MER) (chains I)
ATCAAATATCCACCTGCAGATTCTACCAAAAGTGTATTTGGAAACTGCTCCATCAAAAGG
CATGTTCAGCTCTGTGAGTGAAACTCCATCATCACAAAGAATATTCTGAGAATGCTTCCG
TTTGCCTTTTATATGAACTTCCTCGAT
Sequence of entity 6 (J), FASTA
>6MUO_6 DNA/RNA (147-MER) (chains J)
ATCGAGGAAGTTCATATAAAAGGCAAACGGAAGCATTCTCAGAATATTCTTTGTGATGAT
GGAGTTTCACTCACAGAGCTGAACATGCCTTTTGATGGAGCAGTTTCCAAATACACTTTT
GGTAGAATCTGCAGGTGGATATTTGAT
Sequence of entity 7 (K, L), FASTA
>6MUO_7 Centromere protein C (chains K, L)
TKSRRISRRPSDWWVVKSEE
Sequence of entity 8 (M), FASTA
>6MUO_8 Centromere protein N (chains M)
MDETVAEFIKRTILKIPMNELTTILKAWDFLSENQLQTVNFRQRKESVVQHLIHLCEEKR
ASISDAALLDIIYMQFHQHQKVWDVFQMSKGPGEDVDLFDMKQFKNSFKKILQRALKNVT
VSFRETEENAVWIRIAWGTQYTKPNQYKPTYVVYYSQTPYAFTSSSMLRRNTPLLGQALT
IASKHHQIVKMDLRSRYLDSLKAIVFKQYNQT
Primary citation
Structure of the Human Core Centromeric Nucleosome Complex. Allu, P.K., Dawicki-McKenna, J.M., Van Eeuwen, T. et al. Curr Biol (2019) 29:2625-2639.e5. DOI 10.1016/j.cub.2019.06.062 · PubMed
Other PDB entries of the same protein (UniProt P49450 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 5CVD 1.3 Å, Crystal structure of human NRMT1 in complex with alpha-N-dimethylated human CENP-A peptide
- 6KDQ 1.5 Å, Crystal structure of human NRMT1 in complex with alpha-N-monomethylated human CENP-A…
- 6KDS 1.84 Å, Crystal structure of human NRMT2 in complex with alpha-N-monomethylated human CENP-A…
- 3NQJ 2.1 Å, Crystal structure of (CENP-A/H4)2 heterotetramer
- 7R5R 2.44 Å, Structure of the human CCAN CENP-A alpha-satellite complex
- 3NQU 2.5 Å, Crystal structure of partially trypsinized (CENP-A/H4)2 heterotetramer
- 5ZBX 2.58 Å, The crystal structure of the nucleosome containing histone H3.1 CATD(V76Q, K77D)
- 3R45 2.6 Å, Structure of a CENP-A-Histone H4 Heterodimer in complex with chaperone HJURP
- 6E0P 2.6 Å, Cryo-EM structure of the centromeric nucleosome (Native alpha satellite DNA) in complex…
- 6E0C 2.63 Å, Cryo-EM structure of the CENP-A nucleosome (W601) in complex with a single chain…
- 3WTP 2.67 Å, Crystal Structure of the heterotypic nucleosome containing human CENP-A and H3.3
- 7PII 2.68 Å, Structure of the human CCAN CENP-A alpha-satellite complex
Browse structure collections
About this viewer
MolViewer shows 6MUO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.