6N1Z: Importin-9
Importin-9 bound to H2A-H2B. Determined by X-ray diffraction at 2.7 Å resolution. Released 20 Mar 2019.
- Method
- X-ray diffraction
- Resolution
- 2.7 Å
- Organisms
- Homo sapiens, Xenopus laevis
- Chains
- 6
- Atoms
- 18,161
- Mol. weight
- 287.66 kDa
- Released
- 20 Mar 2019
Explore 6N1Z in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
6N1Z contains 153 α-helices and 20 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 67 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 16-32 | 17 | |
| α-helix | 37-50 | 14 | |
| α-helix | 56-65 | 10 | |
| α-helix | 71-88 | 18 | |
| α-helix | 100-102 | 3 | |
| α-helix | 103-112 | 10 | |
| α-helix | 113-118 | 6 | |
| α-helix | 122-139 | 18 | |
| α-helix | 147-156 | 10 | |
| α-helix | 160-174 | 15 | |
| α-helix | 182-198 | 17 | |
| α-helix | 205-228 | 24 | |
| α-helix | 238-252 | 15 | |
| β-strand | 257 | 1 | 1 |
| β-strand | 260 | 1 | 1 |
| α-helix | 262-278 | 17 | |
| α-helix | 280-283 | 4 | |
| α-helix | 287-305 | 19 | |
| α-helix | 306-310 | 5 | |
| α-helix | 316-318 | 3 | |
| α-helix | 329-344 | 16 | |
| α-helix | 350-367 | 18 | |
| α-helix | 370-371 | 2 | |
| α-helix | 372-380 | 9 | |
| α-helix | 382-388 | 7 | |
| α-helix | 398-412 | 15 | |
| α-helix | 414-437 | 24 | |
| α-helix | 441-443 | 3 | |
| α-helix | 444-456 | 13 | |
| α-helix | 458-466 | 9 | |
| α-helix | 474-476 | 3 | |
| α-helix | 477-483 | 7 | |
| α-helix | 484-486 | 3 | |
| α-helix | 492-504 | 13 | |
| α-helix | 506-508 | 3 | |
| α-helix | 511-525 | 15 | |
| α-helix | 531-550 | 20 | |
| α-helix | 554-560 | 7 | |
| α-helix | 561-572 | 12 | |
| α-helix | 577-590 | 14 | |
| α-helix | 595-600 | 6 | |
| α-helix | 602-615 | 14 | |
| α-helix | 620-634 | 15 | |
| α-helix | 637-656 | 20 | |
| α-helix | 659-661 | 3 | |
| α-helix | 666-680 | 15 | |
| α-helix | 682 | 1 | |
| α-helix | 685-686 | 2 | |
| α-helix | 687 | 1 | |
| α-helix | 688-693 | 6 | |
| α-helix | 694-703 | 10 | |
| α-helix | 707-723 | 17 | |
| α-helix | 725-730 | 6 | |
| β-strand | 732 | 1 | 2 |
| β-strand | 738 | 1 | 2 |
| α-helix | 739-750 | 12 | |
| α-helix | 757-760 | 4 | |
| α-helix | 763-773 | 11 | |
| α-helix | 780-795 | 16 | |
| α-helix | 799-815 | 17 | |
| α-helix | 817-825 | 9 | |
| α-helix | 835-844 | 10 | |
| α-helix | 847-849 | 3 | |
| α-helix | 853-872 | 20 | |
| α-helix | 876-879 | 4 | |
| β-strand | 882-884 | 3 | 3 |
| α-helix | 898-902 | 5 | |
| β-strand | 910-912 | 3 | 3 |
| α-helix | 913-932 | 20 | |
| α-helix | 998-1001 | 4 | |
| α-helix | 1004-1016 | 13 | |
| α-helix | 1021-1025 | 5 | |
| α-helix | 1030-1037 | 8 | |
Chain B: 5 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 20-22 | 3 | |
| α-helix | 28-37 | 10 | |
| β-strand | 44 | 1 | 4 |
| α-helix | 47-73 | 27 | |
| β-strand | 78-79 | 2 | 5 |
| α-helix | 81-89 | 9 | |
| α-helix | 92-101 | 10 | |
Chain C: 4 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 36-46 | 11 | |
| β-strand | 51-52 | 2 | 5 |
| α-helix | 54-81 | 28 | |
| β-strand | 87 | 1 | 4 |
| α-helix | 89-99 | 11 | |
| α-helix | 103-119 | 17 | |
Chain D: 68 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 16-32 | 17 | |
| α-helix | 37-50 | 14 | |
| α-helix | 56-65 | 10 | |
| α-helix | 71-88 | 18 | |
| α-helix | 100-102 | 3 | |
| α-helix | 103-112 | 10 | |
| α-helix | 113-118 | 6 | |
| α-helix | 122-139 | 18 | |
| α-helix | 147-156 | 10 | |
| α-helix | 160-174 | 15 | |
| α-helix | 182-198 | 17 | |
| α-helix | 205-228 | 24 | |
| α-helix | 239-252 | 14 | |
| β-strand | 257 | 1 | 6 |
| β-strand | 260 | 1 | 6 |
| α-helix | 262-278 | 17 | |
| α-helix | 280-283 | 4 | |
| α-helix | 284-286 | 3 | |
| α-helix | 287-305 | 19 | |
| α-helix | 306-310 | 5 | |
| α-helix | 330-344 | 15 | |
| α-helix | 350-354 | 5 | |
| α-helix | 357-367 | 11 | |
| α-helix | 370-371 | 2 | |
| α-helix | 372-380 | 9 | |
| α-helix | 382-388 | 7 | |
| α-helix | 398-412 | 15 | |
| α-helix | 414-437 | 24 | |
| α-helix | 441-443 | 3 | |
| α-helix | 444-456 | 13 | |
| α-helix | 458-466 | 9 | |
| α-helix | 474-476 | 3 | |
| α-helix | 477-483 | 7 | |
| α-helix | 484-486 | 3 | |
| α-helix | 492-504 | 13 | |
| α-helix | 506-508 | 3 | |
| α-helix | 511-525 | 15 | |
| α-helix | 531-550 | 20 | |
| α-helix | 554-556 | 3 | |
| α-helix | 558-560 | 3 | |
| α-helix | 561-572 | 12 | |
| α-helix | 577-593 | 17 | |
| α-helix | 595-600 | 6 | |
| α-helix | 602-615 | 14 | |
| α-helix | 620-634 | 15 | |
| α-helix | 637-656 | 20 | |
| α-helix | 666-680 | 15 | |
| α-helix | 682 | 1 | |
| α-helix | 685-686 | 2 | |
| α-helix | 687 | 1 | |
| α-helix | 688-693 | 6 | |
| α-helix | 694-703 | 10 | |
| α-helix | 707-723 | 17 | |
| α-helix | 725-730 | 6 | |
| β-strand | 732 | 1 | 7 |
| β-strand | 738 | 1 | 7 |
| α-helix | 739-750 | 12 | |
| α-helix | 757-760 | 4 | |
| α-helix | 763-773 | 11 | |
| α-helix | 780-795 | 16 | |
| α-helix | 799-813 | 15 | |
| α-helix | 817-825 | 9 | |
| α-helix | 835-844 | 10 | |
| α-helix | 847-849 | 3 | |
| α-helix | 853-872 | 20 | |
| α-helix | 876-879 | 4 | |
| β-strand | 882-884 | 3 | 8 |
| α-helix | 898-902 | 5 | |
| β-strand | 910-912 | 3 | 8 |
| α-helix | 913-932 | 20 | |
| α-helix | 998-1001 | 4 | |
| α-helix | 1004-1015 | 12 | |
| α-helix | 1021-1025 | 5 | |
| α-helix | 1030-1038 | 9 | |
Chain E: 5 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 18-21 | 4 | |
| α-helix | 28-37 | 10 | |
| β-strand | 44 | 1 | 9 |
| α-helix | 47-73 | 27 | |
| β-strand | 78-79 | 2 | 10 |
| α-helix | 81-89 | 9 | |
| α-helix | 92-100 | 9 | |
Chain F: 4 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 36-46 | 11 | |
| β-strand | 51-52 | 2 | 10 |
| α-helix | 54-77 | 24 | |
| β-strand | 87 | 1 | 9 |
| α-helix | 89-99 | 11 | |
| α-helix | 102-119 | 18 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Importin-9 | A, D | protein | 1041 | Homo sapiens | Q96P70 (AlphaFold model) |
| Histone H2A | B, E | protein | 130 | Xenopus laevis | P06897 (AlphaFold model) |
| Histone H2B 1.1 | C, F | protein | 123 | Xenopus laevis | P02281 (AlphaFold model) |
Sequence of entity 1 (A, D), FASTA
>6N1Z_1 Importin-9 (chains A, D)
MAAAAAAGAASGLPGPVAQGLKEALVDTLTGILSPVQEVRAAAEEQIKVLEVTEEFGVHL
AELTVDPQGALAIRQLASVILKQYVETHWCAQSEKFRPPETTERAKIVIRELLPNGLRES
ISKVRSSVAYAVSAIAHWDWPEAWPQLFNLLMEMLVSGDLNAVHGAMRVLTEFTREVTDT
QMPLVAPVILPEMYKIFTMAEVYGIRTRSRAVEIFTTCAHMICNMEELEKGAAKVLIFPV
VQQFTEAFVQALQIPDGPTSDSGFKMEVLKAVTALVKNFPKHMVSSMQQILPIVWNTLTE
SAAFYVRTEVNYTEEVEDPVDSDGEVLGFENLVFSIFEFVHALLENSKFKSTVKKALPEL
IYYIILYMQITEEQIKVWTANPQQFVEDEDDDTFSYTVRIAAQDLLLAVATDFQNESAAA
LAAAATRHLQEAEQTKNSGTEHWWKIHEACMLALGSVKAIITDSVKNGRIHFDMHGFLTN
VILADLNLSVSPFLLGRALWAASRFTVAMSPELIQQFLQATVSGLHETQPPSVRISAVRA
IWGYCDQLKVSESTHVLQPFLPSILDGLIHLAAQFSSEVLNLVMETLCIVCTVDPEFTAS
MESKICPFTIAIFLKYSNDPVVASLAQDIFKELSQIEACQGPMQMRLIPTLVSIMQAPAD
KIPAGLCATAIDILTTVVRNTKPPLSQLLICQAFPAVAQCTLHTDDNATMQNGGECLRAY
VSVTLEQVAQWHDEQGHNGLWYVMQVVSQLLDPRTSEFTAAFVGRLVSTLISKAGRELGE
NLDQILRAILSKMQQAETLSVMQSLIMVFAHLVHTQLEPLLEFLCSLPGPTGKPALEFVM
AEWTSRQHLFYGQYEGKVSSVALCKLLQHGINADDKRLQDIRVKGEEIYSMDEGIRTRSK
SAKNPERWTNIPLLVKILKLIINELSNVMEANAARQATPAEWSQDDSNDMWEDQEEEEEE
EEDGLAGQLLSDILATSKYEEDYYEDDEEDDPDALKDPLYQIDLQAYLTDFLCQFAQQPC
YIMFSGHLNDNERRVLQTIGI
Sequence of entity 2 (B, E), FASTA
>6N1Z_2 Histone H2A (chains B, E)
MSGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKK
TESSKSAKSK
Sequence of entity 3 (C, F), FASTA
>6N1Z_3 Histone H2B 1.1 (chains C, F)
MAKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIM
NSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYT
SAK
Primary citation
Importin-9 wraps around the H2A-H2B core to act as nuclear importer and histone chaperone. Padavannil, A., Sarkar, P., Kim, S.J. et al. Elife (2019) 8. DOI 10.7554/eLife.43630 · PubMed
Other PDB entries of the same protein (UniProt Q96P70 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 9QON 3.2 Å, Ternary complex of the human 20S proteasome in complex with Importin-9 and two…
- 9QOO 3.3 Å, Composite model: Ternary complex of the human 20S proteasome in complex with Importin-9…
- 10SM 3.5 Å, Importin-9 bound to ETS homologous factor (EHF)
- 9QOP 3.7 Å, Binary complex of human Importin-9 with one homodimer of Akirin-2
- 8F7A 3.78 Å, Cryo-EM structure of Importin-9 bound to RanGTP
- 9QNO 4.2 Å, Ternary complex of the human 20S proteasome in complex with Importin-9 and two…
Browse structure collections
About this viewer
MolViewer shows 6N1Z directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.