6N8Q: Lethal giant larvae protein homolog 2

Crystal structure of the human cell polarity protein Lethal Giant Larvae 2 (Lgl2). Unphosphorylated, crystal form 2. Determined by X-ray diffraction at 2.2 Å resolution. Released 8 May 2019.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Homo sapiens
Chains: 1
Atoms: 6,680
Mol. weight: 109.4 kDa
Released: 8 May 2019

Explore 6N8Q in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6N8Q contains 24 α-helices and 68 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 24 helices, 68 β-strands

Element	Residues	Length	Sheet
α-helix	14-20	7
β-strand	21-30	10	1
α-helix	31-32	2
β-strand	35-41	7	2
β-strand	46-51	6	2
β-strand	55-59	5	2
β-strand	65-69	5	2
β-strand	76-81	6	3
α-helix	82	1
β-strand	87-92	6	3
β-strand	96-105	10	3
β-strand	108-118	11	3
α-helix	127-130	4
β-strand	132-137	6	4
β-strand	143-148	6	4
β-strand	153-157	5	4
β-strand	163	1	4
α-helix	165-167	3
β-strand	169	1	4
α-helix	171-176	6
α-helix	180-182	3
β-strand	191-197	7	5
β-strand	200-208	9	5
β-strand	212-217	6	5
β-strand	222-228	7	5
α-helix	232	1
β-strand	233-238	6	6
β-strand	244-249	6	6
β-strand	254-258	5	6
β-strand	270-272	3	6
β-strand	280	1	7
β-strand	283-289	7	8
β-strand	297-302	6	8
β-strand	305	1	7
α-helix	306-309	4
β-strand	313-319	7	8
β-strand	322-328	7	8
β-strand	332-339	8	9
β-strand	350-357	8	9
β-strand	361-365	5	9
β-strand	373	1	9
β-strand	387-393	7	10
α-helix	398-410	13
α-helix	418-420	3
β-strand	426-427	2	11
α-helix	429-432	4
β-strand	437-442	6	10
β-strand	446-451	6	10
β-strand	458-464	7	10
α-helix	466-468	3
β-strand	469	1	12
β-strand	490-492	3	8
α-helix	503-505	3
β-strand	507-512	6	13
β-strand	518-523	6	13
β-strand	527-534	8	13
β-strand	538	1	14
β-strand	543-548	6	13
α-helix	561-565	5
β-strand	566	1	12
α-helix	567	1
β-strand	573	1	14
β-strand	576-586	11	13
β-strand	593-597	5	15
β-strand	602-606	5	15
β-strand	610-615	6	15
β-strand	620-626	7	15
β-strand	713-721	9	16
β-strand	730-737	8	16
β-strand	741-748	8	16
α-helix	753-755	3
α-helix	759-760	2
β-strand	761-769	9	16
β-strand	776-782	7	17
β-strand	788	1	17
α-helix	789-791	3
α-helix	799-801	3
α-helix	802-804	3
α-helix	808-809	2
β-strand	810-815	6	17
β-strand	818-823	6	17
β-strand	828-834	7	17
α-helix	835-839	5
β-strand	843-851	9	18
β-strand	861-868	8	18
β-strand	872-877	6	18
β-strand	883-888	6	18
α-helix	895-900	6
β-strand	902-903	2	1
β-strand	908-914	7	1
β-strand	917-924	8	1
β-strand	933-934	2	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Lethal(2) giant larvae protein homolog 2	A	protein	979	Homo sapiens	Q6P1M3 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6N8Q_1 Lethal(2) giant larvae protein homolog 2 (chains A)
MRERLKRDLFQFNKTVEHGFPHQPSALGYSPSLRILAIGTRSGAIKLYGAPGVEFMGLHQ
ENNAVTQIHLLPGQCQLVTLLDDNSLHLWSLKVKGGASELQEDESFTLRGPPGAAPSATQ
ITVVLPHSSCELLYLGTESGNVFVVQLPAFRALEDRTISSDAVLQRLPEEARHRRVFEMV
EALQEHPRDPNQILIGYSRGLVVIWDLQGSRVLYHFLSSQQLENIWWQRDGRLLVSCHSD
GSYCQWPVSSEAQQPEPLRSLVPYGPFPCKAITRILWLTTRQGLPFTIFQGGMPRASYGD
RHCISVIHDGQQTAFDFTSRVIGFTVLTEADPAATFDDPYALVVLAEEELVVIDLQTAGW
PPVQLPYLASLHCSAITCSHHVSNIPLKLWERIIAAGSRQNAHFSTMEWPIDGGTSLTPA
PPQRDLLLTGHEDGTVRFWDASGVCLRLLYKLSTVRVFLTDTDPNENFSAQGEDEWPPLR
KVGSFDPYSDDPRLGIQKIFLCKYSGYLAVAGTAGQVLVLELNDEAAEQAVEQVEADLLQ
DQEGYRWKGHERLAARSGPVRFEPGFQPFVLVQCQPPAVVTSLALHSEWRLVAFGTSHGF
GLFDHQQRRQVFVKCTLHPSDQLALEGPLSRVKSLKKSLRQSFRRMRRSRVSSRKRHPAG
PPGEAQEGSAKAERPGLQNMELAPVQRKIEARSAEDSFTGFVRTLYFADTYLKDSSRHCP
SLWAGTNGGTIYAFSLRVPPAERRMDEPVRAEQAKEIQLMHRAPVVGILVLDGHSVPLPE
PLEVAHDLSKSPDMQGSHQLLVVSEEQFKVFTLPKVSAKLKLKLTALEGSRVRRVSVAHF
GSRRAEDYGEHHLAVLTNLGDIQVVSLPLLKPQVRYSCIRREDVSGIASCVFTKYGQGFY
LISPSEFERFSLSTKWLVEPRCLVDSAETKNHRPGNGAGPKKAPSRARNSGTQSDGEEKQ
PGLVMEREFTTASENLYFQ

Primary citation

Structural insights into the aPKC regulatory switch mechanism of the human cell polarity protein lethal giant larvae 2. Almagor, L., Ufimtsev, I.S., Ayer, A. et al. Proc Natl Acad Sci U S A (2019) 116:10804-10812. DOI 10.1073/pnas.1821514116 · PubMed

Other PDB entries of the same protein (UniProt Q6P1M3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6N8R 1.91 Å, Crystal structure of the human cell polarity protein Lethal Giant Larvae 2 (Lgl2). aPKC…
3WP0 2.04 Å, Crystal structure of Dlg GK in complex with a phosphor-Lgl2 peptide
8R3X 2.59 Å, Crystal structure of aPKC Iota kinase domain with LLGL2 peptide
3WP1 2.8 Å, Phosphorylation-dependent interaction between tumor suppressors Dlg and Lgl
9EJK 3.08 Å, Lgl2 bound to the aPKCiota-Par6b complex in nucleotide-free form. Head sub-complex…
6N8P 3.19 Å, Crystal structure of the human cell polarity protein Lethal Giant Larvae 2 (Lgl2).…
9EJM 3.33 Å, Lgl2 bound to the aPKCiota-Par6B complex in its ADP-bound form
9EJL 3.48 Å, Lgl2 bound to the aPKCiota-Par6B complex in nucleotide-free form. Conformation with…
6N8S 3.9 Å, Crystal structure of the human cell polarity protein Lethal Giant Larvae 2 (Lgl2). aPKC…

Browse structure collections

About this viewer

MolViewer shows 6N8Q directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.