Crystal structure of the human cell polarity protein Lethal Giant Larvae 2 (Lgl2). aPKC phosphorylated, crystal form 2. Determined by X-ray diffraction at 1.91 Å resolution. Released 8 May 2019.
Explore 6N8R in 3D Show helices and sheets RCSB PDB PDBe
6N8R contains 24 α-helices and 68 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 14-20 | 7 | |
| β-strand | 21-30 | 10 | 1 |
| α-helix | 31-32 | 2 | |
| β-strand | 35-41 | 7 | 2 |
| β-strand | 46-51 | 6 | 2 |
| β-strand | 55-59 | 5 | 2 |
| β-strand | 65-69 | 5 | 2 |
| β-strand | 76-81 | 6 | 3 |
| α-helix | 82 | 1 | |
| β-strand | 87-92 | 6 | 3 |
| β-strand | 96-105 | 10 | 3 |
| β-strand | 108-118 | 11 | 3 |
| α-helix | 127-130 | 4 | |
| β-strand | 132-137 | 6 | 4 |
| β-strand | 143-148 | 6 | 4 |
| β-strand | 153-157 | 5 | 4 |
| β-strand | 162-163 | 2 | 4 |
| α-helix | 165-167 | 3 | |
| β-strand | 169 | 1 | 4 |
| α-helix | 171-176 | 6 | |
| α-helix | 180-182 | 3 | |
| β-strand | 191-197 | 7 | 5 |
| β-strand | 200-208 | 9 | 5 |
| β-strand | 212-217 | 6 | 5 |
| β-strand | 222-228 | 7 | 5 |
| β-strand | 233-238 | 6 | 6 |
| β-strand | 244-249 | 6 | 6 |
| β-strand | 254-258 | 5 | 6 |
| β-strand | 270-272 | 3 | 6 |
| β-strand | 280 | 1 | 7 |
| β-strand | 283-289 | 7 | 8 |
| β-strand | 297-302 | 6 | 8 |
| β-strand | 305 | 1 | 7 |
| α-helix | 306-309 | 4 | |
| β-strand | 313-319 | 7 | 8 |
| β-strand | 322-328 | 7 | 8 |
| β-strand | 332-339 | 8 | 9 |
| β-strand | 350-357 | 8 | 9 |
| β-strand | 361-365 | 5 | 9 |
| β-strand | 373 | 1 | 9 |
| β-strand | 387-393 | 7 | 10 |
| α-helix | 398-411 | 14 | |
| α-helix | 418-420 | 3 | |
| β-strand | 426-427 | 2 | 11 |
| α-helix | 430-432 | 3 | |
| β-strand | 437-442 | 6 | 10 |
| β-strand | 446-451 | 6 | 10 |
| β-strand | 458-464 | 7 | 10 |
| α-helix | 466-468 | 3 | |
| β-strand | 469 | 1 | 12 |
| β-strand | 490-492 | 3 | 8 |
| α-helix | 503-505 | 3 | |
| β-strand | 507-512 | 6 | 13 |
| β-strand | 518-523 | 6 | 13 |
| β-strand | 527-534 | 8 | 13 |
| β-strand | 538-541 | 4 | 14 |
| β-strand | 543-548 | 6 | 13 |
| α-helix | 562-565 | 4 | |
| β-strand | 566 | 1 | 12 |
| α-helix | 567-568 | 2 | |
| β-strand | 570-573 | 4 | 14 |
| β-strand | 576-586 | 11 | 13 |
| β-strand | 593-597 | 5 | 15 |
| β-strand | 602-606 | 5 | 15 |
| β-strand | 610-615 | 6 | 15 |
| β-strand | 620-626 | 7 | 15 |
| β-strand | 713-721 | 9 | 16 |
| β-strand | 730-737 | 8 | 16 |
| β-strand | 741-748 | 8 | 16 |
| α-helix | 753-755 | 3 | |
| β-strand | 761-769 | 9 | 16 |
| α-helix | 774-775 | 2 | |
| β-strand | 776-782 | 7 | 17 |
| α-helix | 787 | 1 | |
| β-strand | 788 | 1 | 17 |
| α-helix | 789-791 | 3 | |
| α-helix | 794-797 | 4 | |
| α-helix | 799-801 | 3 | |
| α-helix | 808-809 | 2 | |
| β-strand | 810-815 | 6 | 17 |
| β-strand | 818-823 | 6 | 17 |
| β-strand | 828-834 | 7 | 17 |
| α-helix | 835-839 | 5 | |
| β-strand | 843-852 | 10 | 18 |
| β-strand | 860-868 | 9 | 18 |
| β-strand | 873-877 | 5 | 18 |
| β-strand | 883-887 | 5 | 18 |
| α-helix | 895-900 | 6 | |
| β-strand | 902-903 | 2 | 1 |
| β-strand | 908-914 | 7 | 1 |
| β-strand | 917-924 | 8 | 1 |
| β-strand | 933-934 | 2 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Lethal(2) giant larvae protein homolog 2 | A | protein | 979 | Homo sapiens | Q6P1M3 (AlphaFold model) |
>6N8R_1 Lethal(2) giant larvae protein homolog 2 (chains A) MRERLKRDLFQFNKTVEHGFPHQPSALGYSPSLRILAIGTRSGAIKLYGAPGVEFMGLHQ ENNAVTQIHLLPGQCQLVTLLDDNSLHLWSLKVKGGASELQEDESFTLRGPPGAAPSATQ ITVVLPHSSCELLYLGTESGNVFVVQLPAFRALEDRTISSDAVLQRLPEEARHRRVFEMV EALQEHPRDPNQILIGYSRGLVVIWDLQGSRVLYHFLSSQQLENIWWQRDGRLLVSCHSD GSYCQWPVSSEAQQPEPLRSLVPYGPFPCKAITRILWLTTRQGLPFTIFQGGMPRASYGD RHCISVIHDGQQTAFDFTSRVIGFTVLTEADPAATFDDPYALVVLAEEELVVIDLQTAGW PPVQLPYLASLHCSAITCSHHVSNIPLKLWERIIAAGSRQNAHFSTMEWPIDGGTSLTPA PPQRDLLLTGHEDGTVRFWDASGVCLRLLYKLSTVRVFLTDTDPNENFSAQGEDEWPPLR KVGSFDPYSDDPRLGIQKIFLCKYSGYLAVAGTAGQVLVLELNDEAAEQAVEQVEADLLQ DQEGYRWKGHERLAARSGPVRFEPGFQPFVLVQCQPPAVVTSLALHSEWRLVAFGTSHGF GLFDHQQRRQVFVKCTLHPSDQLALEGPLSRVKSLKKSLRQSFRRMRRSRVSSRKRHPAG PPGEAQEGSAKAERPGLQNMELAPVQRKIEARSAEDSFTGFVRTLYFADTYLKDSSRHCP SLWAGTNGGTIYAFSLRVPPAERRMDEPVRAEQAKEIQLMHRAPVVGILVLDGHSVPLPE PLEVAHDLSKSPDMQGSHQLLVVSEEQFKVFTLPKVSAKLKLKLTALEGSRVRRVSVAHF GSRRAEDYGEHHLAVLTNLGDIQVVSLPLLKPQVRYSCIRREDVSGIASCVFTKYGQGFY LISPSEFERFSLSTKWLVEPRCLVDSAETKNHRPGNGAGPKKAPSRARNSGTQSDGEEKQ PGLVMEREFTTASENLYFQ
Structural insights into the aPKC regulatory switch mechanism of the human cell polarity protein lethal giant larvae 2. Almagor, L., Ufimtsev, I.S., Ayer, A. et al. Proc Natl Acad Sci U S A (2019) 116:10804-10812. DOI 10.1073/pnas.1821514116 · PubMed
Other PDB entries of the same protein (UniProt Q6P1M3 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6N8R directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.