6N8W: Unliganded Hsp90-Beta N-Terminal Domain

Structure of Unliganded Hsp90-Beta N-Terminal Domain. Determined by X-ray diffraction at 3.09 Å resolution. Released 3 Jul 2019.

Method: X-ray diffraction
Resolution: 3.09 Å
Organism: Homo sapiens
Chains: 4
Atoms: 6,878
Mol. weight: 115.53 kDa
Released: 3 Jul 2019

Explore 6N8W in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6N8W contains 40 α-helices and 34 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	1-6	6	1
β-strand	13-16	4	2
α-helix	19-30	12
α-helix	38-56	19
α-helix	57-59	3
α-helix	62-65	4
β-strand	73-78	6	2
β-strand	83-88	6	2
α-helix	95-103	9
α-helix	107-117	11
α-helix	123-129	7
α-helix	132-138	7
β-strand	140-148	9	2
β-strand	154-159	6	2
β-strand	164-169	6	2
β-strand	178-185	8	2
α-helix	190-193	4
α-helix	195-204	10
β-strand	213-215	3	2

Chain B: 9 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	12-14	3	3
α-helix	19-28	10
α-helix	38-56	19
α-helix	62-65	4
β-strand	73-78	6	3
β-strand	83-88	6	3
α-helix	95-103	9
α-helix	107-117	11
α-helix	123-129	7
α-helix	134-138	5
β-strand	140-148	9	3
β-strand	154-159	6	3
β-strand	166-169	4	3
β-strand	178-185	8	3
α-helix	191-193	3
α-helix	195-204	10
β-strand	213-217	5	3

Chain C: 11 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	12-16	5	1
α-helix	19-30	12
α-helix	38-57	20
α-helix	62-66	5
β-strand	73-76	4	1
β-strand	85-88	4	1
α-helix	95-99	5
α-helix	100-104	5
α-helix	108-117	10
α-helix	123-125	3
α-helix	127-129	3
α-helix	132-138	7
β-strand	140-148	9	1
β-strand	154-159	6	1
β-strand	164-168	5	1
β-strand	178-185	8	1
α-helix	190-193	4
α-helix	195-204	10
β-strand	213-217	5	1

Chain D: 10 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	1-6	6	3
β-strand	13-16	4	4
α-helix	19-30	12
α-helix	38-59	22
α-helix	62-65	4
β-strand	73-78	6	4
β-strand	83-88	6	4
α-helix	95-100	6
α-helix	101-105	5
α-helix	107-117	11
α-helix	123-129	7
α-helix	132-138	7
β-strand	140-148	9	4
β-strand	154-159	6	4
β-strand	164-168	5	4
β-strand	178-185	8	4
α-helix	190-193	4
α-helix	195-204	10
β-strand	213-215	3	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Heat shock protein HSP 90-beta	A, B, C, D	protein	251	Homo sapiens	P08238 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>6N8W_1 Heat shock protein HSP 90-beta (chains A, B, C, D)
MGSSHHHHHHSSGLVPRGSHMPEEVHHGEEEVETFAFQAEIAQLMSLIINTFYSNKEIFL
RELISNASDALDKIRYESLTDPSKLDSGKELKIDIIPNPQERTLTLVDTGIGMTKADLIN
NLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVAEKVVVITKHNDDEQYAWESS
AGGSFTVRADHGEPIGRGTKVILHLKEDQTEYLEERRVKEVVKKHSQFIGYPITLYLEKE
REKEISDDEAE

Primary citation

Structures of Hsp90 alpha and Hsp90 beta bound to a purine-scaffold inhibitor reveal an exploitable residue for drug selectivity. Huck, J.D., Que, N.L.S., Sharma, S. et al. Proteins (2019) 87:869-877. DOI 10.1002/prot.25750 · PubMed

Other PDB entries of the same protein (UniProt P08238 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9D9I 1.5 Å, Human Hsp90b nucleotide binding domain in complex with BRI2312
6N8Y 1.55 Å, Hsp90-beta bound to PU-11-trans
5UCJ 1.69 Å, Hsp90b N-terminal domain with inhibitors
7ULJ 1.82 Å, Hsp90b N-terminal domain in complex with 42C
9D9H 1.96 Å, Human Hsp90b nucleotide binding domain in complex with BRI2311
5UC4 2.05 Å, Hsp90b N-terminal domain with inhibitors
3FWV 2.2 Å, Crystal Structure of a Redesigned TPR Protein, T-MOD(VMY), in Complex with MEEVF Peptide
3NMQ 2.2 Å, Hsp90b N-terminal domain in complex with EC44, a pyrrolo-pyrimidine methoxypyridine…
3PRY 2.28 Å, Crystal structure of the middle domain of human HSP90-beta refined at 2.3 A resolution
1UYM 2.45 Å, Human Hsp90-beta with PU3 (9-Butyl-8(3,4,5-trimethoxy-benzyl)-9H-purin-6-ylamine)
3UQ3 2.6 Å, TPR2AB-domain:pHSP90-complex of yeast Sti1
9W5I 2.63 Å, AGO maturation complex (AMC): AGO2-miRNA duplex in complex with Hsp90 beta and…

Browse structure collections

About this viewer

MolViewer shows 6N8W directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.