6NT6: Full-length chicken STING in the apo state

Cryo-EM structure of full-length chicken STING in the apo state. Determined by electron microscopy at 4.0 Å resolution. Released 6 Mar 2019.

Method: Electron microscopy
Resolution: 4.0 Å
Organism: Gallus gallus
Chains: 2
Atoms: 4,198
Mol. weight: 88.41 kDa
Released: 6 Mar 2019

Explore 6NT6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6NT6 contains 30 α-helices and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 15 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	24-40	17
α-helix	49-74	26
α-helix	79-83	5
α-helix	88-94	7
α-helix	99-110	12
α-helix	127-139	13
α-helix	143-145	3
α-helix	146-155	10
α-helix	160-168	9
α-helix	169-173	5
α-helix	174-187	14
β-strand	203-208	6	1
α-helix	217-220	4
β-strand	224-226	3	1
β-strand	248-252	5	1
β-strand	260-266	7	1
α-helix	270-278	9
α-helix	286-305	20
β-strand	314-319	6	1
α-helix	331-345	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Stimulator of interferon genes protein	A, B	protein	392	Gallus gallus	E1C7U0 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6NT6_1 Stimulator of interferon genes protein (chains A, B)
MPQDPSTRSSPARLLIPEPRAGRARHAACVLLAVCFVVLFLSGEPLAPIIRSVCTQLAAL
QLGVLLKGCCCLAEEIFHLHSRHHGSLWQVLCSCFPPRWYLALLLVGGSAYLDPPEDNGH
SPRLALTLSCLCQLLVLALGLQKLSAVEVSELTESSKKNVAHGLAWSYYIGYLKVVLPRL
KECMEELSRTNPMLRAHRDTWKLHILVPLGCDIWDDLEKADSNIQYLADLPETILTRAGI
KRRVYKHSLYVIRDKDNKLRPCVLEFASPLQTLCAMSQDDCAAFSREQRLEQARLFYRSL
RDILGSSKECAGLYRLIAYEEPAEPESHFLSGLILWHLQQQQREEYMVQEELPLGTSSVE
LSLQVSSSDLPQPLRSDCPGIHRPDYKDDDDK

Primary citation

Cryo-EM structures of STING reveal its mechanism of activation by cyclic GMP-AMP. Shang, G., Zhang, C., Chen, Z.J. et al. Nature (2019) 567:389-393. DOI 10.1038/s41586-019-0998-5 · PubMed

Other PDB entries of the same protein (UniProt E1C7U0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6NT9 3.3 Å, Cryo-EM structure of the complex between human TBK1 and chicken STING
8IK0 3.3 Å, Cryo-EM structure of Stimulator of interferon genes
6NT7 4.0 Å, Cryo-EM structure of full-length chicken STING in the cGAMP-bound dimeric state
6NT8 6.5 Å, Cryo-EM structure of full-length chicken STING in the cGAMP-bound tetrameric state

Browse structure collections

About this viewer

MolViewer shows 6NT6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.