6NTP: PTP1B Domain of PTP1B-LOV2 Chimera

PTP1B Domain of PTP1B-LOV2 Chimera. Determined by X-ray diffraction at 1.89 Å resolution. Released 22 Jan 2020.

Method: X-ray diffraction
Resolution: 1.89 Å
Organisms: Homo sapiens, Avena sativa
Chains: 1
Atoms: 2,576
Mol. weight: 52.17 kDa
Ligands: MG
Released: 22 Jan 2020

Explore 6NTP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6NTP contains 12 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	3-13	11
α-helix	16-26	11
α-helix	38-43	6
β-strand	56-58	3	1
α-helix	59	1
β-strand	66-74	9	1
β-strand	79-84	6	1
α-helix	85-88	4
α-helix	92-102	11
β-strand	106-109	4	1
β-strand	114-115	2	2
β-strand	118-119	2	2
β-strand	133-135	3	1
β-strand	140-149	10	1
β-strand	153-162	10	1
β-strand	168-176	9	1
α-helix	189-200	12
α-helix	209-210	2
β-strand	211-214	4	1
α-helix	221-237	17
α-helix	241-243	3
α-helix	246-253	8
α-helix	264-280	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tyrosine-protein phosphatase non-receptor type 1,NPH1-1	A	protein	448	Homo sapiens, Avena sativa	O49003 (AlphaFold model), P18031 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6NTP_1 Tyrosine-protein phosphatase non-receptor type 1,NPH1-1 (chains A)
MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLH
QEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLK
CAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWP
DFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKD
PSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDAA
TLERIEKNFVITDPRLPDNPIIFASDSFLQLTEYSREEILGRNCRFLQGPETDRATVRKI
RDAIDNQTEVTVQLINYTKSGKKFWNLFHLQPMRDQKGDVQYFIGVQLDGTEHVRDAAER
EGVMLIKKTAENIDEAAKELLEHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1

Primary citation

Minimally disruptive optical control of protein tyrosine phosphatase 1B. Hongdusit, A., Zwart, P.H., Sankaran, B. et al. Nat Commun (2020) 11:788-788. DOI 10.1038/s41467-020-14567-8 · PubMed

Other PDB entries of the same protein (UniProt O49003 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7PGZ 0.9 Å, Structure of dark-adapted AsLOV2 Q513L
7PH0 0.98 Å, Structure of light-adapted AsLOV2 Q513L
7PGX 1.0 Å, Structure of dark-adapted AsLOV2 wild type
7PGY 1.09 Å, Structure of light-adapted AsLOV2 wild type
2V0U 1.4 Å, n- and c-terminal helices of oat lov2 (404-546) are involved in light-induced signal…
2V1B 1.55 Å, N- and C-terminal helices of oat LOV2 (404-546) are involved in light-induced signal…
2WKQ 1.6 Å, Structure of a photoactivatable Rac1 containing the Lov2 C450A Mutant
2V1A 1.65 Å, N- and C-terminal helices of oat LOV2 (404-546) are involved in light-induced signal…
2V0W 1.7 Å, N- and C-terminal helices of oat LOV2 (404-546) are involved in light- induced signal…
2WKP 1.9 Å, Structure of a photoactivatable Rac1 containing Lov2 Wildtype
4WF0 1.95 Å, Crystal Structure of iLID - an Improved Light-Inducible Dimer
5EFW 2.1 Å, Crystal structure of LOV2-Zdk1 - the complex of oat LOV2 and the affibody protein Zdark1

Browse structure collections

About this viewer

MolViewer shows 6NTP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.