6NTX: Fusion glycoprotein F0

Respiratory syncytial virus fusion protein N-terminal heptad repeat domain+VIQKI. Determined by X-ray diffraction at 2.2 Å resolution. Released 17 Jul 2019.

Method: X-ray diffraction
Resolution: 2.2 Å
Organisms: Human respiratory syncytial virus A, Human respirovirus 3
Chains: 4
Atoms: 1,047
Mol. weight: 19.52 kDa
Released: 17 Jul 2019

Explore 6NTX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6NTX contains 4 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	160-200	41

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	160-196	37

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	453-482	30

Chain D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	459-482	24

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Fusion glycoprotein F0	A, B	protein	53	Human respiratory syncytial virus A	P03420
Fusion glycoprotein F0	C, D	protein	38	Human respirovirus 3	P06828

Sequence of entity 1 (A, B), FASTA

>6NTX_1 Fusion glycoprotein F0 (chains A, B)
XHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKX

Sequence of entity 2 (C, D), FASTA

>6NTX_2 Fusion glycoprotein F0 (chains C, D)
XVALDPIDISIVLNKIKSQLEESKEWIRRSNKILDSIX

Primary citation

Dual Inhibition of Human Parainfluenza Type 3 and Respiratory Syncytial Virus Infectivity with a Single Agent. Outlaw, V.K., Bottom-Tanzer, S., Kreitler, D.F. et al. J Am Chem Soc (2019) 141:12648-12656. DOI 10.1021/jacs.9b04615 · PubMed

Other PDB entries of the same protein (UniProt P03420), best resolution first:

29QJ 1.32 Å, Respiratory syncytial virus fusion protein N-terminal heptad repeat domain in complex…
6OJ7 1.45 Å, Respiratory syncytial virus fusion glycoprotein N-terminal heptad repeat domain+VIQKI…
3KPE 1.47 Å, Solution structure of the respiratory syncytial virus (RSV)six-helix bundle complexed…
9RA5 1.63 Å, Respiratory syncytial virus fusion protein N-terminal heptad repeat domain in complex…
3O41 1.95 Å, Crystal Structure of 101F Fab Bound to 15-mer Peptide Epitope
9VWE 2.06 Å, Cryo-EM structure of RSV pre-F (strain A2) in complex with Fabs 1A2 and 2D10
6VKE 2.1 Å, Crystal Structure of Inhibitor JNJ-40012665 in Complex with Prefusion RSV F Glycoprotein
7LVW 2.1 Å, Structure of RSV F in Complex with VHH Cl184
8DG9 2.24 Å, Cryo-EM Structure of RSV prefusion F trimer in complex with three MxR Fabs
8PHI 2.29 Å, Crystal structure of prefusion-stabilized RSV F Variant DS-Cav1 in complex with Lonafarnib
5C69 2.3 Å, Crystal Structure of Prefusion-stabilized RSV F variant PR-DM
5EA4 2.3 Å, Crystal Structure of Inhibitor JNJ-49153390 in Complex with Prefusion RSV F Glycoprotein

Browse structure collections

About this viewer

MolViewer shows 6NTX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.