6OF8: PDB entry 6OF8
Structure of Thr354Asn, Glu355Gln, Thr412Asn, Ile414Met, Ile464His, and Phe467Met mutant human CamKII-alpha hub domain. Determined by X-ray diffraction at 2.1 Å resolution. Released 17 Apr 2019.
- Method
- X-ray diffraction
- Resolution
- 2.1 Å
- Organism
- Homo sapiens
- Chains
- 7
- Atoms
- 7,486
- Mol. weight
- 109.33 kDa
- Released
- 17 Apr 2019
Explore 6OF8 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
6OF8 contains 35 α-helices and 42 β-strands across 7 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 4 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 343-362 | 20 | |
| α-helix | 366-372 | 7 | |
| β-strand | 373-380 | 8 | 6 |
| α-helix | 382-384 | 3 | |
| β-strand | 388-390 | 3 | 6 |
| α-helix | 393-401 | 9 | |
| β-strand | 410-421 | 12 | 6 |
| β-strand | 426-438 | 13 | 6 |
| β-strand | 444-458 | 15 | 6 |
| β-strand | 461-471 | 11 | 6 |
Chain B: 5 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 344-363 | 20 | |
| α-helix | 366-372 | 7 | |
| β-strand | 373-380 | 8 | 2 |
| α-helix | 382-384 | 3 | |
| β-strand | 388-390 | 3 | 2 |
| α-helix | 393-398 | 6 | |
| α-helix | 399-403 | 5 | |
| β-strand | 411-422 | 12 | 2 |
| β-strand | 426-438 | 13 | 2 |
| β-strand | 444-458 | 15 | 2 |
| β-strand | 461-470 | 10 | 2 |
Chain C: 5 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 344-363 | 20 | |
| α-helix | 366-372 | 7 | |
| β-strand | 373-380 | 8 | 3 |
| α-helix | 382-384 | 3 | |
| β-strand | 389-390 | 2 | 3 |
| α-helix | 393-398 | 6 | |
| α-helix | 399-403 | 5 | |
| β-strand | 411-421 | 11 | 3 |
| β-strand | 426-438 | 13 | 3 |
| β-strand | 444-458 | 15 | 3 |
| β-strand | 461-471 | 11 | 3 |
Chain D: 5 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 344-363 | 20 | |
| α-helix | 366-372 | 7 | |
| β-strand | 373-380 | 8 | 7 |
| α-helix | 382-384 | 3 | |
| β-strand | 388-390 | 3 | 7 |
| α-helix | 393-398 | 6 | |
| α-helix | 399-403 | 5 | |
| β-strand | 411-421 | 11 | 7 |
| β-strand | 426-438 | 13 | 7 |
| β-strand | 444-458 | 15 | 7 |
| β-strand | 461-471 | 11 | 7 |
Chain E: 5 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 347-363 | 17 | |
| α-helix | 366-372 | 7 | |
| β-strand | 373-380 | 8 | 5 |
| α-helix | 382-384 | 3 | |
| β-strand | 388-390 | 3 | 5 |
| α-helix | 393-398 | 6 | |
| α-helix | 399-403 | 5 | |
| β-strand | 411-421 | 11 | 5 |
| β-strand | 426-438 | 13 | 5 |
| β-strand | 444-458 | 15 | 5 |
| β-strand | 461-471 | 11 | 5 |
Chain F: 6 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 347-362 | 16 | |
| α-helix | 366-372 | 7 | |
| β-strand | 373-380 | 8 | 1 |
| α-helix | 382-384 | 3 | |
| α-helix | 387 | 1 | |
| β-strand | 388-390 | 3 | 1 |
| α-helix | 393-398 | 6 | |
| α-helix | 399-404 | 6 | |
| β-strand | 410-421 | 12 | 1 |
| β-strand | 426-438 | 13 | 1 |
| β-strand | 444-458 | 15 | 1 |
| β-strand | 461-471 | 11 | 1 |
Chain G: 5 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 344-363 | 20 | |
| α-helix | 366-372 | 7 | |
| β-strand | 373-380 | 8 | 4 |
| α-helix | 382-384 | 3 | |
| β-strand | 389-390 | 2 | 4 |
| α-helix | 391-397 | 7 | |
| α-helix | 398-402 | 5 | |
| β-strand | 411-422 | 12 | 4 |
| β-strand | 426-438 | 13 | 4 |
| β-strand | 444-457 | 14 | 4 |
| β-strand | 462-470 | 9 | 4 |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Calcium/calmodulin-dependent protein kinase type II subunit alpha | A, B, C, D, E, F, G | protein | 135 | Homo sapiens | Q9UQM7 (AlphaFold model) |
Sequence of entity 1 (A, B, C, D, E, F, G), FASTA
>6OF8_1 Calcium/calmodulin-dependent protein kinase type II subunit alpha (chains A, B, C, D, E, F, G)
GPHMVRKQEIIKVNQQLIEAISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFE
NLWSRNSKPVHNTMLNPHIHLMGDESACIAYIRITQYLDAGGIPRTAQSEETRVWHRRDG
KWQHVHMHRSGAPSV
Primary citation
Variation in assembly stoichiometry in non-metazoan homologs of the hub domain of Ca2+/calmodulin-dependent protein kinase II. McSpadden, E.D., Xia, Z., Chi, C.C. et al. Protein Sci (2019) 28:1071-1082. DOI 10.1002/pro.3614 · PubMed
Other PDB entries of the same protein (UniProt Q9UQM7 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 6X5G 1.85 Å, Cocrystal structure of human CaMKII-alpha (CAMK2A)kinase domain and LRRC7 inhibitory…
- 7UJR 1.95 Å, Cocrystal structure of human CaMKII-alpha (CAMK2A)kinase domain and GluN2B
- 7UJT 2.1 Å, Cocrystal structure of human CaMKII-alpha (CAMK2A)kinase domain and GluN2B(S1303D) in…
- 9EOY 2.1 Å, Structure of Thr354Asn, Glu355Gln, Thr412Asn, Ile414Met, Ile464His, and Phe467Met mutant…
- 6X5Q 2.14 Å, Cocrystal structure of human CaMKII-alpha (CAMK2A)kinase domain and GluA1
- 7REC 2.2 Å, Structure of Thr354Asn, Glu355Gln, Thr412Asn, Ile414Met, Ile464His, and Phe467Met mutant…
- 7UJQ 2.25 Å, Cocrystal structure of human CaMKII-alpha (CAMK2A)kinase domain and GluN2B
- 2VZ6 2.3 Å, Structure of human calcium calmodulin dependent protein kinase type II alpha (CAMK2A) in…
- 7KL0 2.4 Å, Cocrystal structure of human CaMKII-alpha (CAMK2A)kinase domain and GluN2B(S1303D)
- 7KL1 2.4 Å, Cocrystal structure of human CaMKII-alpha (CAMK2A)kinase domain and GluN2B(S1303D)
- 6VZK 2.55 Å, Crystal structure of human CaMKII-alpha (CAMK2A)kinase domain
- 7KL2 2.56 Å, Cocrystal structure of human CaMKII-alpha (CAMK2A)kinase domain and GluN2B(S1303D)
Browse structure collections
About this viewer
MolViewer shows 6OF8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.