6OUS: Fusion glycoprotein F2

Structure of fusion glycoprotein from human respiratory syncytial virus. Determined by X-ray diffraction at 3.4 Å resolution. Released 30 Oct 2019.

Method: X-ray diffraction
Resolution: 3.4 Å
Organisms: Human respiratory syncytial virus A2, Human immunodeficiency virus 1, Homo sapiens
Chains: 24
Atoms: 41,597
Mol. weight: 623.85 kDa
Ligands: NAG
Released: 30 Oct 2019

Explore 6OUS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6OUS contains 205 α-helices and 445 β-strands across 24 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 4 β-strands

Element	Residues	Length	Sheet
β-strand	29-33	5	1
β-strand	38-48	11	1
β-strand	49	1	2
β-strand	51-60	10	3
α-helix	76-96	21

Chain B: 21 helices, 29 β-strands

Element	Residues	Length	Sheet
α-helix	138-141	4
β-strand	144	1	4
α-helix	149-158	10
α-helix	163-170	8
β-strand	176-180	5	3
β-strand	186-194	9	3
α-helix	196-198	3
α-helix	199-203	5
α-helix	218-240	23
β-strand	243-244	2	3
α-helix	247-248	2
α-helix	254-262	9
α-helix	268-276	9
α-helix	278-283	6
β-strand	286-289	4	3
β-strand	296-305	10	3
β-strand	308-318	11	1
β-strand	321-322	2	5
β-strand	333-336	4	5
β-strand	340-345	6	1
β-strand	348-352	5	1
β-strand	359-361	3	1
β-strand	364-366	3	1
β-strand	368	1	2
α-helix	369-371	3
β-strand	373-375	3	1
α-helix	377-380	4
α-helix	381-384	4
β-strand	395-398	4	5
β-strand	404-407	4	6
β-strand	411-416	6	6
β-strand	422-426	5	7
β-strand	430-434	5	7
α-helix	435-436	2
β-strand	438-443	6	6
β-strand	449-452	4	7
β-strand	455-458	4	7
α-helix	459-460	2
β-strand	465-469	5	1
α-helix	474-477	4
β-strand	487	1	5
α-helix	492-504	13
α-helix	505-509	5
α-helix	510-513	4
α-helix	514-517	4
β-strand	519	1	8
α-helix	521-524	4
β-strand	530	1	9
β-strand	532-533	2	9
β-strand	536-537	2	9

Chains C, E, I and K: 1 helix, 4 β-strands

Element	Residues	Length	Sheet
β-strand	29-33	5	10
β-strand	38-48	11	10
β-strand	49	1	11
β-strand	51-60	10	12
α-helix	74-97	24

Chain D: 18 helices, 27 β-strands

Element	Residues	Length	Sheet
α-helix	139-141	3
β-strand	144	1	6
α-helix	149-158	10
α-helix	163-170	8
β-strand	176-180	5	12
β-strand	186-194	9	12
α-helix	196-198	3
α-helix	199-203	5
α-helix	218-239	22
β-strand	243-244	2	12
α-helix	247-248	2
α-helix	254-263	10
α-helix	268-276	9
α-helix	278-283	6
β-strand	286-291	6	12
β-strand	296-305	10	12
β-strand	308-318	11	10
β-strand	321-322	2	13
β-strand	333-336	4	13
β-strand	340-345	6	10
β-strand	348-352	5	10
α-helix	355-357	3
β-strand	359-361	3	10
β-strand	364-366	3	10
β-strand	368	1	11
α-helix	369-371	3
β-strand	373-375	3	10
α-helix	377-380	4
α-helix	381-384	4
β-strand	395-398	4	13
β-strand	404-407	4	14
β-strand	411-416	6	14
β-strand	422-426	5	15
β-strand	430-434	5	15
α-helix	435-436	2
β-strand	438-443	6	14
β-strand	449-452	4	15
β-strand	455-458	4	15
α-helix	459-460	2
β-strand	465-469	5	10
α-helix	474-477	4
β-strand	487	1	13
α-helix	492-517	26
β-strand	529-533	5	9
β-strand	536-539	4	9

Chain F: 20 helices, 28 β-strands

Element	Residues	Length	Sheet
α-helix	139-141	3
β-strand	144	1	14
α-helix	149-158	10
α-helix	163-170	8
β-strand	176-180	5	18
β-strand	186-194	9	18
α-helix	196-198	3
α-helix	199-203	5
α-helix	204-207	4
α-helix	218-240	23
β-strand	243-244	2	18
α-helix	247-248	2
α-helix	254-262	9
α-helix	268-276	9
α-helix	278-283	6
β-strand	286-293	8	18
β-strand	296-305	10	18
β-strand	308-318	11	16
β-strand	321-322	2	19
β-strand	333-336	4	19
β-strand	340-345	6	16
β-strand	348-352	5	16
β-strand	359-361	3	16
β-strand	364-366	3	16
β-strand	368	1	17
α-helix	369-371	3
β-strand	373-375	3	16
α-helix	377-380	4
α-helix	381-384	4
β-strand	394-398	5	19
β-strand	404-407	4	4
β-strand	411-416	6	4
β-strand	422-426	5	20
β-strand	430-434	5	20
α-helix	435-436	2
β-strand	438-443	6	4
β-strand	449-452	4	20
β-strand	455-458	4	20
α-helix	459-460	2
β-strand	465-469	5	16
α-helix	474-477	4
β-strand	487-491	5	19
α-helix	492-513	22
β-strand	521	1	8
α-helix	522-524	3
β-strand	529-533	5	9
β-strand	536-539	4	9
α-helix	540-542	3

Chain G: 1 helix, 4 β-strands

Element	Residues	Length	Sheet
β-strand	28-33	6	21
β-strand	38-48	11	21
β-strand	49	1	22
β-strand	51-60	10	23
α-helix	74-97	24

Chain H: 21 helices, 25 β-strands

Element	Residues	Length	Sheet
α-helix	139-141	3
β-strand	144	1	24
α-helix	149-158	10
α-helix	163-170	8
β-strand	176-180	5	23
β-strand	186-194	9	23
α-helix	196-198	3
α-helix	199-203	5
α-helix	218-239	22
β-strand	243-244	2	23
α-helix	247-248	2
α-helix	254-262	9
α-helix	268-276	9
α-helix	278-283	6
β-strand	286-289	4	23
β-strand	296-305	10	23
β-strand	308-318	11	21
β-strand	321-322	2	25
β-strand	333-336	4	25
β-strand	340-345	6	21
β-strand	348-352	5	21
α-helix	355-357	3
β-strand	359-361	3	21
β-strand	364-366	3	21
β-strand	368	1	22
α-helix	369-371	3
β-strand	373-375	3	21
α-helix	377-380	4
α-helix	381-384	4
β-strand	394-398	5	25
β-strand	404-407	4	26
β-strand	411-416	6	26
β-strand	422-426	5	27
β-strand	430-434	5	27
α-helix	435-436	2
β-strand	438-443	6	26
β-strand	449-452	4	27
β-strand	455-458	4	27
α-helix	459-460	2
β-strand	464-469	6	21
α-helix	474-477	4
β-strand	487-491	5	25
α-helix	492-499	8
α-helix	500-507	8
α-helix	508-513	6
α-helix	521-524	4

Chain J: 18 helices, 25 β-strands

Element	Residues	Length	Sheet
α-helix	138-141	4
β-strand	144	1	26
α-helix	149-158	10
α-helix	163-170	8
β-strand	176-180	5	30
β-strand	186-194	9	30
α-helix	196-198	3
α-helix	199-203	5
α-helix	204-207	4
α-helix	218-240	23
β-strand	243-244	2	30
α-helix	247-248	2
α-helix	254-263	10
α-helix	268-276	9
α-helix	278-283	6
β-strand	286-293	8	30
β-strand	296-305	10	30
β-strand	308-318	11	28
β-strand	321-322	2	31
β-strand	333-336	4	31
β-strand	340-345	6	28
β-strand	348-352	5	28
β-strand	359-361	3	28
β-strand	364-366	3	28
β-strand	368	1	29
α-helix	369-371	3
β-strand	373-375	3	28
α-helix	377-380	4
α-helix	381-384	4
β-strand	394-398	5	31
β-strand	404-407	4	32
β-strand	411-416	6	32
β-strand	422-426	5	33
β-strand	430-434	5	33
α-helix	435-436	2
β-strand	438-443	6	32
β-strand	449-452	4	33
β-strand	455-458	4	33
α-helix	459-460	2
β-strand	465-469	5	28
α-helix	474-477	4
β-strand	487-491	5	31
α-helix	492-513	22

12 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Fusion glycoprotein F2	A, C, E, G, I, K	protein	84	Human respiratory syncytial virus A2	P03420
Fusion glycoprotein F1 fused with Fibritin trimerization domain	B, D, F, H, J, L	protein	414	Human respiratory syncytial virus A2, Human immunodeficiency virus 1	M1E1E4 (AlphaFold model), P03420
RB1 Fab Heavy Chain	M, O, Q, S, U, W	protein	231	Homo sapiens
RB1 Fab Light chain	N, P, R, T, V, X	protein	214	Homo sapiens

Sequence of entity 1 (A, C, E, G, I, K), FASTA

>6OUS_1 Fusion glycoprotein F2 (chains A, C, E, G, I, K)
QNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDK
YKNAVTELQLLMQSTPATNNRARR

Sequence of entity 2 (B, D, F, H, J, L), FASTA

>6OUS_2 Fusion glycoprotein F1 fused with Fibritin trimerization domain (chains B, D, F, H, J, L)
FLGFLLGVGSAIASGVAVCKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTFKVLDLK
NYIDKQLLPILNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSE
LLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMCIIKEEVLAYVVQLPLYGVIDTPCWKL
HTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLP
SEVNLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFS
NGCDYVSNKGVDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVN
EKINQSLAFIRKSDELLSAIGGYIPEAPRDGQAYVRKDGEWVLLSTFLGGLVPR

Sequence of entity 3 (M, O, Q, S, U, W), FASTA

>6OUS_3 RB1 Fab Heavy Chain (chains M, O, Q, S, U, W)
EVQLVESGGGLVRPGRSLRLSCTVSGFSFDDSAMSWVRQAPGKGLEWISFIKSKTYGGTK
EYAASVKGRFTISRDDSKNIAYLQMNSLKTEDTAVYYCTRGAPYGGNSDYYYGLDVWGQG
TTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTF
PAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCD

Sequence of entity 4 (N, P, R, T, V, X), FASTA

>6OUS_4 RB1 Fab Light chain (chains N, P, R, T, V, X)
DIQMTQSPSSLSASVGDRVTITCRTSQDVRGALAWYQQKPGKAPKLLIFDASSLETGVPS
RFSGSGSGTVFTLTISSLQPEDFAAYYCQQFLDFPFTFGQGTRLEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	4

Primary citation

A potent broadly neutralizing human RSV antibody targets conserved site IV of the fusion glycoprotein. Tang, A., Chen, Z., Cox, K.S. et al. Nat Commun (2019) 10:4153-4153. DOI 10.1038/s41467-019-12137-1 · PubMed

Other PDB entries of the same protein (UniProt P03420), best resolution first:

29QJ 1.32 Å, Respiratory syncytial virus fusion protein N-terminal heptad repeat domain in complex…
6OJ7 1.45 Å, Respiratory syncytial virus fusion glycoprotein N-terminal heptad repeat domain+VIQKI…
3KPE 1.47 Å, Solution structure of the respiratory syncytial virus (RSV)six-helix bundle complexed…
9RA5 1.63 Å, Respiratory syncytial virus fusion protein N-terminal heptad repeat domain in complex…
3O41 1.95 Å, Crystal Structure of 101F Fab Bound to 15-mer Peptide Epitope
9VWE 2.06 Å, Cryo-EM structure of RSV pre-F (strain A2) in complex with Fabs 1A2 and 2D10
6VKE 2.1 Å, Crystal Structure of Inhibitor JNJ-40012665 in Complex with Prefusion RSV F Glycoprotein
7LVW 2.1 Å, Structure of RSV F in Complex with VHH Cl184
6NTX 2.2 Å, Respiratory syncytial virus fusion protein N-terminal heptad repeat domain+VIQKI
8DG9 2.24 Å, Cryo-EM Structure of RSV prefusion F trimer in complex with three MxR Fabs
8PHI 2.29 Å, Crystal structure of prefusion-stabilized RSV F Variant DS-Cav1 in complex with Lonafarnib
5C69 2.3 Å, Crystal Structure of Prefusion-stabilized RSV F variant PR-DM

Browse structure collections

About this viewer

MolViewer shows 6OUS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.