6PGQ: Maltodextrin-binding protein,Calcitonin receptor

Crystal structure of N-glycosylated human calcitonin receptor extracellular domain in complex with salmon calcitonin (22-32). Determined by X-ray diffraction at 2.85 Å resolution. Released 12 Feb 2020.

Method: X-ray diffraction
Resolution: 2.85 Å
Organisms: Escherichia coli, Homo sapiens, Oncorhynchus sp.
Chains: 2
Atoms: 3,874
Mol. weight: 56.29 kDa
Ligands: NAG
Released: 12 Feb 2020

Explore 6PGQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6PGQ contains 31 α-helices and 35 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 30 helices, 35 β-strands

Element	Residues	Length	Sheet
α-helix	-331--330	2
β-strand	-326--323	4	1
α-helix	-316--302	15
β-strand	-298--295	4	1
α-helix	-290--283	8
β-strand	-274--270	5	1
α-helix	-269--267	3
α-helix	-266--261	6
β-strand	-257	1	2
α-helix	-256--254	3
α-helix	-250--246	5
β-strand	-244	1	3
α-helix	-242--237	6
β-strand	-235--234	2	4
β-strand	-231--230	2	4
β-strand	-227--222	6	1
β-strand	-219--215	5	5
β-strand	-205	1	6
α-helix	-204--202	3
α-helix	-201--192	10
β-strand	-188--186	3	5
α-helix	-179--170	10
β-strand	-166--161	6	7
β-strand	-158--151	8	7
α-helix	-147--133	15
α-helix	-123--115	9
β-strand	-111--106	6	5
α-helix	-104--102	3
α-helix	-101--95	7
β-strand	-91--88	4	5
α-helix	-87--85	3
β-strand	-84	1	6
β-strand	-83	1	8
β-strand	-80	1	8
α-helix	-76	1
β-strand	-75--74	2	9
β-strand	-73--67	7	1
β-strand	-66	1	2
α-helix	-60--54	7
α-helix	-53--49	5
α-helix	-46--37	10
β-strand	-32--31	2	1
β-strand	-29	1	3
α-helix	-28--22	7
α-helix	-18--7	12
β-strand	-5--4	2	9
α-helix	-3--2	2
α-helix	3-18	16
α-helix	24-35	12
α-helix	37-61	25
α-helix	63-64	2
β-strand	71-72	2	10
α-helix	73-74	2
β-strand	75-76	2	11
β-strand	81-82	2	11
β-strand	85-86	2	10
β-strand	90-94	5	12
α-helix	95-96	2
β-strand	107-111	5	12
β-strand	112	1	13
α-helix	113	1
β-strand	118	1	13
β-strand	120	1	14
β-strand	127	1	14
β-strand	130	1	12

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	23-26	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Maltodextrin-binding protein,Calcitonin receptor	A	protein	482	Escherichia coli, Homo sapiens	P30988 (AlphaFold model)
Calcitonin	B	protein	12	Oncorhynchus sp.	P01263 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6PGQ_1 Maltodextrin-binding protein,Calcitonin receptor (chains A)
MAKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPD
IIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYN
KDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDI
KDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTS
KVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKP
LGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVD
EALKDAQTNAAAEFLYVVGRKKMMDAQYKCYDRMQQLPAYQGEGPYCNRTWDGWLCWDDT
PAGVLSYQFCPDYFPDFDPSEKVTKYCDEKGVWFKHPENNRTWSNYTMCNAFTPEKHHHH
HH

Sequence of entity 2 (B), FASTA

>6PGQ_2 Calcitonin (chains B)
YPRTNTGSGTPX

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	3

Water and common crystallization additives (ACT) are not listed.

Primary citation

Calcitonin Receptor N-Glycosylation Enhances Peptide Hormone Affinity by Controlling Receptor Dynamics. Lee, S.M., Jeong, Y., Simms, J. et al. J Mol Biol (2020) 432:1996-2014. DOI 10.1016/j.jmb.2020.01.028 · PubMed

Other PDB entries of the same protein (UniProt P30988 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6PFO 1.78 Å, Crystal structure of N-glycosylated human calcitonin receptor extracellular domain in…
8F0K 1.9 Å, Human Amylin3 Receptor in complex with Gs and Pramlintide analogue peptide San385
8F0J 2.0 Å, Calcitonin Receptor in complex with Gs and Pramlintide analogue peptide San45
8F2B 2.0 Å, Amylin 3 Receptor in complex with Gs and Pramlintide analogue peptide San45
5II0 2.1 Å, Crystal structure of the human calcitonin receptor ectodomain in complex with a…
7TYF 2.2 Å, Human Amylin1 Receptor in complex with Gs and rat amylin peptide
8F2A 2.2 Å, Human Amylin3 Receptor in complex with Gs and Pramlintide analogue peptide San385…
9BP3 2.2 Å, Human Amylin1 Receptor in complex with Gs and cagrilintide
9BUB 2.3 Å, Human calcitonin Receptor in complex with Gs and cagrilintide in the bypass conformation
7TZF 2.4 Å, Human Amylin3 Receptor in complex with Gs and rat amylin peptide
9AUC 2.4 Å, Human Amylin1 Receptor in Complex with Gs and human Calcitonin Gene-Related Peptide
9BUD 2.5 Å, Human calcitonin Receptor in complex with Gs and cagrilintide in the CT-like conformation

Browse structure collections

About this viewer

MolViewer shows 6PGQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.