6PSV: Protein TraR

Escherichia coli RNA polymerase promoter unwinding intermediate (TpreRPo) with TraR and rpsT P2 promoter. Determined by electron microscopy at 3.5 Å resolution. Released 25 Mar 2020.

Method: Electron microscopy
Resolution: 3.5 Å
Organism: Escherichia coli
Chains: 10
Atoms: 32,331
Mol. weight: 562.9 kDa
Ligands: ZN, 1N7, MG
Released: 25 Mar 2020

Explore 6PSV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6PSV contains 174 α-helices and 227 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain G: 6 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	13-17	5	2
β-strand	23-31	9	2
α-helix	35-49	15
β-strand	53	1	3
β-strand	56-59	4	4
β-strand	61	1	4
β-strand	74	1	5
α-helix	78-80	3
α-helix	82-85	4
β-strand	90-91	2	6
β-strand	97-104	8	4
β-strand	108-111	4	5
α-helix	112-114	3
β-strand	115-116	2	4
β-strand	122-123	2	6
β-strand	129-133	5	5
β-strand	140-147	8	4
β-strand	149	1	3
β-strand	153	1	7
α-helix	155-158	4
β-strand	171-172	2	4
β-strand	175	1	7
β-strand	180-189	10	2
β-strand	199-207	9	2
α-helix	213-233	21

Chain H: 6 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	19	1	8
β-strand	23-31	9	8
α-helix	32	1
α-helix	35-49	15
β-strand	54-61	8	9
β-strand	74	1	10
α-helix	78-86	9
β-strand	90	1	11
β-strand	99-101	3	9
β-strand	104-105	2	12
β-strand	109-111	3	13
α-helix	112-114	3
β-strand	123	1	11
β-strand	129-132	4	13
β-strand	133	1	10
β-strand	139-140	2	12
β-strand	142-148	7	9
β-strand	152-153	2	14
β-strand	172	1	9
β-strand	175-176	2	14
β-strand	180-183	4	8
β-strand	188-190	3	8
β-strand	198-207	10	8
α-helix	213-227	15
α-helix	228-230	3

Chain I: 62 helices, 102 β-strands

Element	Residues	Length	Sheet
α-helix	5-7	3
β-strand	13-14	2	15
α-helix	19-20	2
α-helix	29-38	10
α-helix	49-56	8
α-helix	57	1
β-strand	59-60	2	16
β-strand	66-75	10	16
α-helix	83-88	6
β-strand	93-105	13	16
α-helix	106	1
α-helix	113	1
β-strand	114-118	5	16
β-strand	121-128	8	16
α-helix	129	1
β-strand	130	1	17
β-strand	136-137	2	17
β-strand	142-145	4	17
α-helix	146	1
β-strand	147-151	5	18
α-helix	152	1
β-strand	154-158	5	19
β-strand	173-177	5	19
β-strand	180	1	20
β-strand	186	1	19
β-strand	187-188	2	21
β-strand	194-196	3	21
β-strand	204-205	2	21
α-helix	207-212	6
α-helix	217-224	8
β-strand	227-231	5	22
β-strand	238-240	3	22
α-helix	244-246	3
β-strand	250	1	23
β-strand	255-257	3	24
β-strand	260-263	4	24
β-strand	268	1	23
α-helix	271-276	6
α-helix	277-281	5
β-strand	284-286	3	22
α-helix	289-292	4
β-strand	296-297	2	22
β-strand	315-316	2	22
α-helix	319-326	8
β-strand	332-336	5	22
β-strand	339	1	25
β-strand	343	1	25
α-helix	346-353	8
α-helix	359-370	12
α-helix	378-390	13
β-strand	396	1	20
α-helix	399-408	10
α-helix	422-437	16
α-helix	442-444	3
β-strand	451-454	4	18
α-helix	456-480	25
α-helix	496-507	12
β-strand	512-514	3	17
α-helix	515-516	2
α-helix	521-524	4
β-strand	529	1	26
β-strand	530-531	2	18
β-strand	535	1	27
β-strand	537	1	27
α-helix	552-554	3
β-strand	558	1	28
β-strand	574	1	26
β-strand	575	1	28
β-strand	576	1	29
β-strand	580-581	2	30
β-strand	587-588	2	30
β-strand	589-594	6	31
β-strand	598	1	32
β-strand	599-606	8	31
α-helix	608-613	6
β-strand	616	1	31
β-strand	623	1	33
β-strand	628	1	32
β-strand	629	1	33
β-strand	633-636	4	34
β-strand	637	1	31
β-strand	643-646	4	34
α-helix	647-649	3
β-strand	652-654	3	31
β-strand	662	1	29
α-helix	676-685	10
α-helix	686-688	3
β-strand	689	1	35
β-strand	700	1	15
α-helix	705-710	6
β-strand	716-717	2	36
β-strand	722-727	6	37
β-strand	731-736	6	37
α-helix	738-740	3
β-strand	749-752	4	37
β-strand	757-758	2	38
β-strand	763	1	39
β-strand	764-765	2	38
β-strand	768-769	2	36
β-strand	776-777	2	37
β-strand	782-785	4	36
β-strand	789	1	40
β-strand	794	1	40
β-strand	798-804	7	41
β-strand	816-819	4	41
α-helix	821-824	4
β-strand	830-831	2	42
β-strand	832	1	39
β-strand	834-841	8	43
β-strand	842-843	2	44
β-strand	846-847	2	44
β-strand	849	1	45
α-helix	859-862	4
β-strand	865	1	46
β-strand	870	1	47
β-strand	871	1	46
α-helix	872	1
β-strand	882-884	3	47
β-strand	887-888	2	45
α-helix	897-902	6
α-helix	903-907	5
α-helix	909-911	3
β-strand	914-915	2	45
β-strand	918-919	2	47
α-helix	920-921	2
β-strand	927-935	9	43
α-helix	940-942	3
α-helix	943-980	38
α-helix	986-989	4
α-helix	994-997	4
α-helix	1007-1036	30
β-strand	1046-1055	10	43
β-strand	1057-1058	2	42
β-strand	1066-1067	2	48
β-strand	1076-1080	5	41
β-strand	1087-1088	2	49
α-helix	1092	1
β-strand	1093	1	49
α-helix	1094	1
β-strand	1096	1	41
α-helix	1102-1105	4
α-helix	1110-1129	20
α-helix	1139-1150	12
α-helix	1166-1175	10
β-strand	1182-1183	2	15
α-helix	1186-1188	3
α-helix	1192-1201	10
β-strand	1209-1210	2	41
β-strand	1212-1213	2	49
α-helix	1219	1
β-strand	1220	1	49
α-helix	1221	1
β-strand	1225-1232	8	41
β-strand	1233-1234	2	48
β-strand	1235	1	35
α-helix	1239-1242	4
β-strand	1244-1246	3	50
β-strand	1252	1	51
β-strand	1268-1269	2	52
α-helix	1273-1280	8
α-helix	1284-1290	7
α-helix	1298-1309	12
α-helix	1321-1331	11
β-strand	1335-1337	3	53

Chain J: 60 helices, 81 β-strands

Element	Residues	Length	Sheet
β-strand	22-24	3	53
α-helix	27-33	7
β-strand	34	1	54
β-strand	44	1	55
β-strand	51	1	55
α-helix	52	1
α-helix	59-62	4
β-strand	84	1	56
β-strand	91	1	56
α-helix	95-99	5
β-strand	102	1	54
β-strand	103-112	10	57
α-helix	123-126	4
α-helix	132-139	8
β-strand	144-145	2	58
β-strand	159-160	2	58
α-helix	162-171	10
β-strand	179	1	58
α-helix	181-190	10
α-helix	195-207	13
α-helix	213-229	17
α-helix	234-237	4
β-strand	238-244	7	57
β-strand	252-254	3	59
α-helix	255	1
β-strand	260-262	3	59
α-helix	265-285	21
α-helix	289-307	19
β-strand	317	1	60
β-strand	323	1	60
α-helix	324	1
α-helix	337	1
α-helix	338-342	5
β-strand	346-347	2	52
β-strand	350-354	5	50
β-strand	355-356	2	61
β-strand	365-369	5	61
α-helix	370-376	7
α-helix	378-388	11
α-helix	394-403	10
α-helix	406-415	10
β-strand	421-424	4	50
α-helix	431-433	3
β-strand	434-437	4	50
β-strand	438-442	5	61
β-strand	447-448	2	61
α-helix	454-457	4
β-strand	465-469	5	50
α-helix	474-479	6
α-helix	480-484	5
β-strand	485	1	50
α-helix	486-488	3
β-strand	491	1	62
β-strand	498	1	62
α-helix	505-513	9
β-strand	526-527	2	63
α-helix	530-537	8
β-strand	547-556	10	63
β-strand	564-573	10	63
α-helix	574-580	7
α-helix	589-591	3
α-helix	598-612	15
α-helix	615-633	19
α-helix	645-647	3
α-helix	650-670	21
α-helix	675-702	28
β-strand	706-707	2	64
β-strand	714-715	2	64
α-helix	721-727	7
β-strand	746-748	3	65
α-helix	749	1
β-strand	754-758	5	65
α-helix	769-786	18
α-helix	790-803	14
β-strand	809-811	3	66
β-strand	821-822	2	67
β-strand	826	1	68
β-strand	831	1	68
α-helix	835-839	5
β-strand	843	1	69
β-strand	844	1	70
α-helix	847	1
β-strand	848-849	2	71
α-helix	850	1
β-strand	856-858	3	71
β-strand	863	1	69
α-helix	866-874	9
β-strand	880-881	2	67
β-strand	882	1	70
β-strand	894-895	2	66
α-helix	896-899	4
β-strand	901	1	72
β-strand	908	1	72
α-helix	909-910	2
α-helix	915-924	10
α-helix	925-928	4
β-strand	956-961	6	73
β-strand	965-967	3	74
β-strand	973-975	3	74
β-strand	981-985	5	73
β-strand	991-996	6	73
β-strand	1002-1003	2	74
β-strand	1010-1011	2	73
β-strand	1019	1	74
β-strand	1033-1035	3	75
β-strand	1038	1	76
β-strand	1042	1	77
β-strand	1046-1048	3	77
β-strand	1059-1061	3	77
β-strand	1077-1079	3	76
β-strand	1080-1081	2	75
β-strand	1087	1	75
β-strand	1089-1090	2	78
β-strand	1093-1096	4	78
β-strand	1098-1100	3	76
β-strand	1106-1107	2	77
β-strand	1114-1115	2	75
β-strand	1122-1123	2	77
α-helix	1139-1145	7
α-helix	1153-1155	3
β-strand	1156	1	79
β-strand	1162-1165	4	80
β-strand	1170	1	81
β-strand	1172	1	81
β-strand	1173-1178	6	80
β-strand	1186-1190	5	80
α-helix	1204-1205	2
β-strand	1209	1	79
α-helix	1217-1219	3
α-helix	1220-1224	5
α-helix	1226-1244	19
α-helix	1251-1260	10
β-strand	1263-1266	4	82
β-strand	1279-1281	3	82
α-helix	1282-1294	13
β-strand	1302-1304	3	82
α-helix	1311-1314	4
α-helix	1320-1325	6
α-helix	1328-1337	10
α-helix	1347-1352	6
α-helix	1361-1372	12

Chain K: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	9-12	4
α-helix	18-31	14
α-helix	46-55	10
α-helix	62-75	14

Chain L: 26 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	97-106	10
α-helix	115-135	21
α-helix	138-152	15
α-helix	158-160	3
β-strand	162	1	83
α-helix	214-232	19
α-helix	245-255	11
α-helix	256-258	3
β-strand	261	1	83
α-helix	263-288	26
α-helix	299-306	8
α-helix	327-329	3
α-helix	334-351	18
α-helix	355-391	37
α-helix	401-417	17
α-helix	421-423	3
α-helix	427-445	19
α-helix	454-474	21
α-helix	480-486	7
α-helix	493-500	8
α-helix	502-504	3
β-strand	505-506	2	59
α-helix	519-522	4
β-strand	524	1	51
α-helix	529-530	2
α-helix	531-550	20
α-helix	553-562	10
α-helix	573-577	5
α-helix	584-599	16
α-helix	605-610	6

Chain M: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	251-253	3
α-helix	264-273	10
α-helix	278-281	4
α-helix	286-290	5
α-helix	297-308	12

Chain N: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	4-25	22
β-strand	36	1	1
α-helix	42	1
β-strand	43	1	1
α-helix	44	1
α-helix	46-51	6
α-helix	59-70	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein TraR	N	protein	72	Escherichia coli	P41065 (AlphaFold model)
DNA-directed RNA polymerase subunit alpha	G, H, M	protein	329	Escherichia coli	P0A7Z4 (AlphaFold model)
DNA-directed RNA polymerase subunit beta	I	protein	1342	Escherichia coli	P0A8V2 (AlphaFold model)
DNA-directed RNA polymerase subunit beta'	J	protein	1430	Escherichia coli	P0A8T7 (AlphaFold model)
DNA-directed RNA polymerase subunit omega	K	protein	91	Escherichia coli	P0A800
RNA polymerase sigma factor RpoD	L	protein	616	Escherichia coli	P00579
DNA (85-mer)	O	DNA	85	Escherichia coli
DNA (85-mer)	P	DNA	85	Escherichia coli

Sequence of entity 1 (N), FASTA

>6PSV_1 Protein TraR (chains N)
SDEADEAYSVTEQLTMTGINRIRQKINAHGIPVYLCEACGNPIPEARRKIFPGVTLCVEC
QAYQERQRKHYA

Sequence of entity 2 (G, H, M), FASTA

>6PSV_2 DNA-directed RNA polymerase subunit alpha (chains G, H, M)
MQGSVTEFLKPRLVDIEQVSSTHAKVTLEPLERGFGHTLGNALRRILLSSMPGCAVTEVE
IDGVLHEYSTKEGVQEDILEILLNLKGLAVRVQGKDEVILTLNKSGIGPVTAADITHDGD
VEIVKPQHVICHLTDENASISMRIKVQRGRGYVPASTRIHSEEDERPIGRLLVDACYSPV
ERIAYNVEAARVEQRTDLDKLVIEMETNGTIDPEEAIRRAATILAEQLEAFVDLRDVRQP
EVKEEKPEFDPILLRPVDDLELTVRSANCLKAEAIHYIGDLVQRTEVELLKTPNLGKKSL
TEIKDVLASRGLSLGMRLENWPPASIADE

Sequence of entity 3 (I), FASTA

>6PSV_3 DNA-directed RNA polymerase subunit beta (chains I)
MVYSYTEKKRIRKDFGKRPQVLDVPYLLSIQLDSFQKFIEQDPEGQYGLEAAFRSVFPIQ
SYSGNSELQYVSYRLGEPVFDVQECQIRGVTYSAPLRVKLRLVIYEREAPEGTVKDIKEQ
EVYMGEIPLMTDNGTFVINGTERVIVSQLHRSPGVFFDSDKGKTHSSGKVLYNARIIPYR
GSWLDFEFDPKDNLFVRIDRRRKLPATIILRALNYTTEQILDLFFEKVIFEIRDNKLQME
LVPERLRGETASFDIEANGKVYVEKGRRITARHIRQLEKDDVKLIEVPVEYIAGKVVAKD
YIDESTGELICAANMELSLDLLAKLSQSGHKRIETLFTNDLDHGPYISETLRVDPTNDRL
SALVEIYRMMRPGEPPTREAAESLFENLFFSEDRYDLSAVGRMKFNRSLLREEIEGSGIL
SKDDIIDVMKKLIDIRNGKGEVDDIDHLGNRRIRSVGEMAENQFRVGLVRVERAVKERLS
LGDLDTLMPQDMINAKPISAAVKEFFGSSQLSQFMDQNNPLSEITHKRRISALGPGGLTR
ERAGFEVRDVHPTHYGRVCPIETPEGPNIGLINSLSVYAQTNEYGFLETPYRKVTDGVVT
DEIHYLSAIEEGNYVIAQANSNLDEEGHFVEDLVTCRSKGESSLFSRDQVDYMDVSTQQV
VSVGASLIPFLEHDDANRALMGANMQRQAVPTLRADKPLVGTGMERAVAVDSGVTAVAKR
GGVVQYVDASRIVIKVNEDEMYPGEAGIDIYNLTKYTRSNQNTCINQMPCVSLGEPVERG
DVLADGPSTDLGELALGQNMRVAFMPWNGYNFEDSILVSERVVQEDRFTTIHIQELACVS
RDTKLGPEEITADIPNVGEAALSKLDESGIVYIGAEVTGGDILVGKVTPKGETQLTPEEK
LLRAIFGEKASDVKDSSLRVPNGVSGTVIDVQVFTRDGVEKDKRALEIEEMQLKQAKKDL
SEELQILEAGLFSRIRAVLVAGGVEAEKLDKLPRDRWLELGLTDEEKQNQLEQLAEQYDE
LKHEFEKKLEAKRRKITQGDDLAPGVLKIVKVYLAVKRRIQPGDKMAGRHGNKGVISKIN
PIEDMPYDENGTPVDIVLNPLGVPSRMNIGQILETHLGMAAKGIGDKINAMLKQQQEVAK
LREFIQRAYDLGADVRQKVDLSTFSDEEVMRLAENLRKGMPIATPVFDGAKEAEIKELLK
LGDLPTSGQIRLYDGRTGEQFERPVTVGYMYMLKLNHLVDDKMHARSTGSYSLVTQQPLG
GKAQFGGQRFGEMEVWALEAYGAAYTLQEMLTVKSDDVNGRTKMYKNIVDGNHQMEPGMP
ESFNVLLKEIRSLGINIELEDE

Sequence of entity 4 (J), FASTA

>6PSV_4 DNA-directed RNA polymerase subunit beta' (chains J)
VKDLLKFLKAQTKTEEFDAIKIALASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCAR
IFGPVKDYECLCGKYKRLKHRGVICEKCGVEVTQTKVRRERMGHIELASPTAHIWFLKSL
PSRIGLLLDMPLRDIERVLYFESYVVIEGGMTNLERQQILTEEQYLDALEEFGDEFDAKM
GAEAIQALLKSMDLEQECEQLREELNETNSETKRKKLTKRIKLLEAFVQSGNKPEWMILT
VLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKRLLDLAAPDIIVRNEKRMLQ
EAVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQNLLGKRVDYSGRSVITVGPY
LRLHQCGLPKKMALELFKPFIYGKLELRGLATTIKAAKKMVEREEAVVWDILDEVIREHP
VLLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLEA
RALMMSTNNILSPANGEPIIVPSQDVVLGLYYMTRDCVNAKGEGMVLTGPKEAERLYRSG
LASLHARVKVRITEYEKDANGELVAKTSLKDTTVGRAILWMIVPKGLPYSIVNQALGKKA
ISKMLNTCYRILGLKPTVIFADQIMYTGFAYAARSGASVGIDDMVIPEKKHEIISEAEAE
VAEIQEQFQSGLVTAGERYNKVIDIWAAANDRVSKAMMDNLQTETVINRDGQEEKQVSFN
SIYMMADSGARGSAAQIRQLAGMRGLMAKPDGSIIETPITANFREGLNVLQYFISTHGAR
KGLADTALKTANSGYLTRRLVDVAQDLVVTEDDCGTHEGIMMTPVIEGGDVKEPLRDRVL
GRVTAEDVLKPGTADILVPRNTLLHEQWCDLLEENSVDAVKVRSVVSCDTDFGVCAHCYG
RDLARGHIINKGEAIGVIAAQSIGEPGTQLTMRTFHIGGAASRAAAESSIQVKNKGSIKL
SNVKSVVNSSGKLVITSRNTELKLIDEFGRTKESYKVPYGAVLAKGDGEQVAGGETVANW
DPHTMPVITEVSGFVRFTDMIDGQTITRQTDELTGLSSLVVLDSAERTAGGKDLRPALKI
VDAQGNDVLIPGTDMPAQYFLPGKAIVQLEDGVQISSGDTLARIPQESGGTKDITGGLPR
VADLFEARRPKEPAILAEISGIVSFGKETKGKRRLVITPVDGSDPYEEMIPKWRQLNVFE
GERVERGDVISDGPEAPHDILRLRGVHAVTRYIVNEVQDVYRLQGVKINDKHIEVIVRQM
LRKATIVNAGSSDFLEGEQVEYSRVKIANRELEANGKVGATYSRDLLGITKASLATESFI
SAASFQETTRVLTEAAVAGKRDELRGLKENVIVGRLIPAGTGYAYHQDRMRRRAAGEAPA
APQVTAEDASASLAELLNAGLGGSDNELELEVLFQGPSSGHHHHHHHHHH

Sequence of entity 5 (K), FASTA

>6PSV_5 DNA-directed RNA polymerase subunit omega (chains K)
MARVTVQDAVEKIGNRFDLVLVAARRARQMQVGGKDPLVPEENDKTTVIALREIEEGLIN
NQILDVRERQEQQEQEAAELQAVTAIAEGRR

Sequence of entity 6 (L), FASTA

>6PSV_6 RNA polymerase sigma factor RpoD (chains L)
SEFMEQNPQSQLKLLVTRGKEQGYLTYAEVNDHLPEDIVDSDQIEDIIQMINDMGIQVME
EAPDADDLMLAENTADEDAAEAAAQVLSSVESEIGRTTDPVRMYMREMGTVELLTREGEI
DIAKRIEDGINQVQCSVAEYPEAITYLLEQYDRVEAEEARLSDLITGFVDPNAEEDLAPT
ATHVGSELSQEDLDDDEDEDEEDGDDDSADDDNSIDPELAREKFAELRAQYVVTRDTIKA
KGRSHATAQEEILKLSEVFKQFRLVPKQFDYLVNSMRVMMDRVRTQERLIMKLCVEQCKM
PKKNFITLFTGNETSDTWFNAAIAMNKPWSEKLHDVSEEVHRALQKLQQIEEETGLTIEQ
VKDINRRMSIGEAKARRAKKEMVEANLRLVISIAKKYTNRGLQFLDLIQEGNIGLMKAVD
KFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMIETINKLNRISRQMLQEMGRE
PTPEELAERMLMPEDKIRKVLKIAKEPISMETPIGDDEDSHLGDFIEDTTLELPLDSATT
ESLRAATHDVLAGLTAREAKVLRMRFGIDMNTDYTLEEVGKQFDVTRERIRQIEAKALRK
LRHPSRSEVLRSFLDD

Sequence of entity 7 (O), FASTA

>6PSV_7 DNA (85-MER) (chains O)
GGCGGCGCTTATTTGCACAAATCCATTGACAAAAGAAGGCTAAAAGGGCATATTCCTCGG
CCTTTGAATTGTCCATATAGAACGC

Sequence of entity 8 (P), FASTA

>6PSV_8 DNA (85-MER) (chains P)
GCGTTCTATATGGACAATTCAAAGGCCGAGGAATATGCCCTTTTAGCCTTCTTTTGTCAA
TGGATTTGTGCAAATAAGCGCCGCC

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	3
1N7	Chapso	C32 H59 N2 O8 S	4
MG	Magnesium ion	Mg	1

Primary citation

Stepwise Promoter Melting by Bacterial RNA Polymerase. Chen, J., Chiu, C., Gopalkrishnan, S. et al. Mol Cell (2020) 78:275. DOI 10.1016/j.molcel.2020.02.017 · PubMed

Other PDB entries of the same protein (UniProt P41065 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6PST 3.0 Å, Escherichia coli RNA polymerase promoter unwinding intermediate (TRPi1.5b) with TraR and…
6PSQ 3.4 Å, Escherichia coli RNA polymerase closed complex (TRPc) with TraR and rpsT P2 promoter
6PSR 3.4 Å, Escherichia coli RNA polymerase promoter unwinding intermediate (TRPi1) with TraR and…
6PSS 3.5 Å, Escherichia coli RNA polymerase promoter unwinding intermediate (TRPi1.5a) with TraR and…
6N57 3.7 Å, Cryo-EM structure of Escherichia coli RNAP polymerase bound with TraR in conformation I
6PSW 3.7 Å, Escherichia coli RNA polymerase promoter unwinding intermediate (TRPo) with TraR and…
6N58 3.78 Å, Cryo-EM structure of Escherichia coli RNAP polymerase bound with TraR in conformation II
5W1S 3.81 Å, X-ray crystal structure of Escherichia coli RNA polymerase and TraR complex
6PSU 3.9 Å, Escherichia coli RNA polymerase promoter unwinding intermediate (TRPi2) with TraR and…

Browse structure collections

About this viewer

MolViewer shows 6PSV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.