6QIY: CI-2, conformation 1

CI-2, conformation 1. Determined by X-ray diffraction at 1.5 Å resolution. Released 25 Dec 2019.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: Hordeum vulgare
Chains: 1
Atoms: 592
Mol. weight: 7.41 kDa
Released: 25 Dec 2019

Explore 6QIY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6QIY contains 2 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	6	1	1
α-helix	8-10	3
β-strand	14	1	2
α-helix	15-25	11
β-strand	30-35	6	1
β-strand	48-53	6	1
β-strand	58	1	2
β-strand	59	1	1
β-strand	64-65	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Subtilisin-chymotrypsin inhibitor-2A	A	protein	65	Hordeum vulgare	P01053 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6QIY_1 Subtilisin-chymotrypsin inhibitor-2A (chains A)
DLKTEWPELVGKSVEEAKKVILQDKPEAQIIVLPVGTIVTMEYRIDRVRLFVDKLDNIAE
VPRVG

Primary citation

Engineering protein assemblies with allosteric control via monomer fold-switching. Campos, L.A., Sharma, R., Alvira, S. et al. Nat Commun (2019) 10:5703-5703. DOI 10.1038/s41467-019-13686-1 · PubMed

Other PDB entries of the same protein (UniProt P01053 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7A3M 1.01 Å, Synergistic stabilization of a double mutant in CI2 from an in-cell library screen
7AON 1.3 Å, Crystal structure of CI2 double mutant L49I,I57V
1LW6 1.5 Å, Crystal Structure of the Complex of Subtilisin BPN' with Chymotrypsin Inhibitor 2 at 1.5…
6QIZ 1.65 Å, CI-2, conformation 2
1YPC 1.7 Å, Direct observation of better hydration at the N-terminus of an alpha-helix with glycine…
1CQ4 1.8 Å, CI2 mutant with tetraglutamine (mgqqqqgm) replacing MET59
5FFN 1.8 Å, Complex of subtilase SubTY from Bacillus sp. TY145 with chymotrypsin inhibitor CI2A
7AOK 1.87 Å, Crystal structure of CI2 mutant L49I
5FBZ 1.9 Å, Structure of subtilase SubHal from Bacillus halmapalus - complex with chymotrypsin…
7A1H 1.9 Å, Crystal structure of wild-type CI2
1YPA 2.0 Å, Direct observation of better hydration at the N-terminus of an alpha-helix with glycine…
1YPB 2.0 Å, Direct observation of better hydration at the N-terminus of an alpha-helix with glycine…

Browse structure collections

About this viewer

MolViewer shows 6QIY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.