7AOK: CI2 mutant L49I

Crystal structure of CI2 mutant L49I. Determined by X-ray diffraction at 1.87 Å resolution. Released 9 Dec 2020.

Method: X-ray diffraction
Resolution: 1.87 Å
Organism: Hordeum vulgare
Chains: 1
Atoms: 538
Mol. weight: 7.51 kDa
Released: 9 Dec 2020

Explore 7AOK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7AOK contains 2 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	4	1	1
α-helix	6-8	3
β-strand	12	1	2
α-helix	13-23	11
β-strand	28-33	6	1
β-strand	46-51	6	1
β-strand	56	1	2
β-strand	57	1	1
β-strand	62-63	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Subtilisin-chymotrypsin inhibitor-2A	A	protein	64	Hordeum vulgare	P01053 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7AOK_1 Subtilisin-chymotrypsin inhibitor-2A (chains A)
MKTEWPELVGKSVEEAKKVILQDKPEAQIIVLPVGTIVTMEYRIDRVRIFVDKLDNIAQV
PRVG

Primary citation

Synergistic stabilization of a double mutant in chymotrypsin inhibitor 2 from a library screen in E. coli. Hamborg, L., Granata, D., Olsen, J.G. et al. Commun Biol (2021) 4:980-980. DOI 10.1038/s42003-021-02490-7 · PubMed

Other PDB entries of the same protein (UniProt P01053 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7A3M 1.01 Å, Synergistic stabilization of a double mutant in CI2 from an in-cell library screen
7AON 1.3 Å, Crystal structure of CI2 double mutant L49I,I57V
1LW6 1.5 Å, Crystal Structure of the Complex of Subtilisin BPN' with Chymotrypsin Inhibitor 2 at 1.5…
6QIY 1.5 Å, CI-2, conformation 1
6QIZ 1.65 Å, CI-2, conformation 2
1YPC 1.7 Å, Direct observation of better hydration at the N-terminus of an alpha-helix with glycine…
1CQ4 1.8 Å, CI2 mutant with tetraglutamine (mgqqqqgm) replacing MET59
5FFN 1.8 Å, Complex of subtilase SubTY from Bacillus sp. TY145 with chymotrypsin inhibitor CI2A
5FBZ 1.9 Å, Structure of subtilase SubHal from Bacillus halmapalus - complex with chymotrypsin…
7A1H 1.9 Å, Crystal structure of wild-type CI2
1YPA 2.0 Å, Direct observation of better hydration at the N-terminus of an alpha-helix with glycine…
1YPB 2.0 Å, Direct observation of better hydration at the N-terminus of an alpha-helix with glycine…

Browse structure collections

About this viewer

MolViewer shows 7AOK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.