6QU1: KAP1 RBCC domain

Crystal structure of the KAP1 RBCC domain in complex with the SMARCAD1 CUE1 domain at 3.7 angstrom resolution. Determined by X-ray diffraction at 3.7 Å resolution. Released 17 Jul 2019.

Method: X-ray diffraction
Resolution: 3.7 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,444
Mol. weight: 41.59 kDa
Ligands: ZN
Released: 17 Jul 2019

Explore 6QU1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6QU1 contains 11 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	74-76	3
β-strand	78-80	3	1
β-strand	86-88	3	1
α-helix	126-128	3
β-strand	130-131	2	1
α-helix	132	1
β-strand	219-221	3	2
β-strand	226-228	3	2
α-helix	232-235	4
β-strand	243-244	2	2
α-helix	245-354	110
α-helix	360-363	4
α-helix	367-378	12
α-helix	399-408	10

Chain D: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	152-168	17
α-helix	174-183	10
α-helix	188-197	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription intermediary factor 1-beta,Transcription intermediary factor 1-beta	A	protein	322	Homo sapiens	Q13263 (AlphaFold model)
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing…	D	protein	48	Homo sapiens	Q9H4L7 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6QU1_1 Transcription intermediary factor 1-beta,Transcription intermediary factor 1-beta (chains A)
GGGAEALELLEHCGVCRERLRPEREPRLLPCLHSACSACLGPAAPAAANSSGDGGAAGDG
TVVDCPVCKQQCFSKDIVENYFMRDSGSKAGERTVYCNVHKHEPLVLFCESCDTLTCRDC
QLNAHKDHQYQFLEDAVRNQRKLLASLVKRLGDKHATLQKSTKEVRSSIRQVSDVQKRVQ
VDVKMAILQIMKELNKRGRVLVNDAQKVTEGQQERLERQHWTMTKIQKHQEHILRFASWA
LESDNNTALLLSKKLIYFQLHRALKMIVDPVEPHGEMKFQWDLNAWTKSAEAFGKIVAER
PGTNSTGPAPMAPPRAPGPLSK

Sequence of entity 2 (D), FASTA

>6QU1_2 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 (chains D)
LSELEDLKDAKLQTLKELFPQRSDNDLLKLIESTSTMDGAIAAALLMF

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	4

Primary citation

A Ubiquitin-Binding Domain that Binds a Structural Fold Distinct from that of Ubiquitin. Lim, M., Newman, J.A., Williams, H.L. et al. Structure (2019). DOI 10.1016/j.str.2019.05.003 · PubMed

Other PDB entries of the same protein (UniProt Q13263 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9OSC 1.77 Å, Crystal structure of HP1gamma chromoshadow domain in complex with KAP1 peptide
2YVR 1.8 Å, Crystal structure of MS1043
9CDW 2.4 Å, Crystal structure of HP1alpha chromoshadow domain in complex with KAP1 peptide
7Z36 2.8 Å, Crystal structure of the KAP1 tripartite motif in complex with the ZNF93 KRAB domain
6QAJ 2.9 Å, Structure of the tripartite motif of KAP1/TRIM28
6H3A 5.5 Å, Crystal structure of the KAP1 RBCC domain in complex with the SMARCAD1 CUE1 domain.
1FP0 Solution structure of the phd domain from the kap-1 corepressor
2RO1 NMR Solution Structures of Human KAP1 PHD finger-bromodomain
6I9H Solution structure of TRIM28 RING domain

Browse structure collections

About this viewer

MolViewer shows 6QU1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.